![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 109587 | ||||||||
| Common Name | MYB4A-1, SELMODRAFT_450007 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 129aa MW: 14966.3 Da PI: 10.5593 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 57.5 | 3e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg+WT eEd ll+++++ +G g+W+t ++ g++R++k+c++rw +yl
109587 14 RGPWTREEDALLIKYITAHGEGSWRTLPKQAGLRRCGKSCRLRWINYL 61
89********************************************97 PP
| |||||||
| 2 | Myb_DNA-binding | 55.6 | 1.2e-17 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg+ T+eEdel+++++ +lG++ W++Ia ++ gRt++++k++w+++l
109587 67 RGNITEEEDELIIKLHSLLGNR-WSLIAGRLA-GRTDNEIKNYWNTHL 112
8999******************.*********.************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 18.363 | 9 | 61 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 1.25E-30 | 11 | 108 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 3.7E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.5E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.7E-25 | 15 | 68 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 2.61E-9 | 16 | 61 | No hit | No description |
| PROSITE profile | PS51294 | 28.069 | 62 | 116 | IPR017930 | Myb domain |
| SMART | SM00717 | 3.5E-17 | 66 | 114 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.2E-15 | 67 | 112 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 2.3E-27 | 69 | 116 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.08E-11 | 71 | 112 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009751 | Biological Process | response to salicylic acid | ||||
| GO:0009753 | Biological Process | response to jasmonic acid | ||||
| GO:0010224 | Biological Process | response to UV-B | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:0090378 | Biological Process | seed trichome elongation | ||||
| GO:1903086 | Biological Process | negative regulation of sinapate ester biosynthetic process | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 129 aa Download sequence Send to blast |
MGRAPCCEKV GLNRGPWTRE EDALLIKYIT AHGEGSWRTL PKQAGLRRCG KSCRLRWINY 60 LRPDLKRGNI TEEEDELIIK LHSLLGNRWS LIAGRLAGRT DNEIKNYWNT HLKKKLRSMG 120 IDPHTHRPL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 5e-29 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 111 | 117 | LKKKLRS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00479 | DAP | Transfer from AT4G38620 | Download |
| |||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002978781.2 | 4e-91 | transcription factor MYB34 isoform X2 | ||||
| Refseq | XP_002984694.2 | 4e-91 | transcription factor MYB34 isoform X2 | ||||
| Swissprot | Q9SZP1 | 3e-72 | MYB4_ARATH; Transcription repressor MYB4 | ||||
| TrEMBL | D8S5T8 | 6e-89 | D8S5T8_SELML; Uncharacterized protein MYB4A-1 (Fragment) | ||||
| STRING | EFJ20228 | 1e-89 | (Selaginella moellendorffii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP5 | 17 | 1784 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G38620.1 | 1e-74 | myb domain protein 4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 109587 |
| Entrez Gene | 9653888 |




