PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

111283

Common Name

SELMODRAFT_111283

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

LBD

Protein Properties

Length: 116aa MW: 13068.1 Da PI: 8.2815

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
111283	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	99.4	3.4e-31	4	96	1	93
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 aC aC+ l+ +C+++C +apyf +qp++fanvh +FG+snv k+l++l +ed +++l+ye ++r++dP+yG+v+vi+ lq++ ++++++ 111283 4 ACTACRNLQWRCTPECLFAPYFLPDQPERFANVHNVFGVSNVRKMLNELLVYFHEDCINTLAYEVDMRVKDPIYGCVSVISVLQKRAARTQNH 96 7************************************************************************************99998864 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	18.116	3	104	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	4.8E-33	4	96	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 116 aa Download sequence Send to blast
TTSACTACRN LQWRCTPECL FAPYFLPDQP ERFANVHNVF GVSNVRKMLN ELLVYFHEDC 60 INTLAYEVDM RVKDPIYGCV SVISVLQKRA ARTQNHKYLA LATPCSSSMF SPGTR*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	5e-36	3	96	10	103	LOB family transfactor Ramosa2.1
5ly0_B	5e-36	3	96	10	103	LOB family transfactor Ramosa2.1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation (By similarity). {ECO:0000250}.
UniProt	Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation (By similarity). {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024356367.1	7e-39	protein LATERAL ORGAN BOUNDARIES-like isoform X1
Refseq	XP_024356368.1	5e-39	protein LATERAL ORGAN BOUNDARIES-like isoform X2
Refseq	XP_024356369.1	5e-39	protein LATERAL ORGAN BOUNDARIES-like isoform X2
Refseq	XP_024356370.1	5e-39	protein LATERAL ORGAN BOUNDARIES-like isoform X2
Refseq	XP_024356371.1	5e-39	protein LATERAL ORGAN BOUNDARIES-like isoform X2
Swissprot	A2WXT0	2e-36	LBD6_ORYSI; LOB domain-containing protein 6
Swissprot	Q8LQH4	2e-36	LBD6_ORYSJ; LOB domain-containing protein 6
TrEMBL	D8S8Z2	9e-82	D8S8Z2_SELML; Uncharacterized protein (Fragment)
STRING	EFJ19252	2e-82	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP60	16	318

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G65620.4	2e-38	LBD family protein

Link Out ? help Back to Top
Phytozome	111283
Entrez Gene	9636165

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031]