![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 113962 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 71aa MW: 8076.59 Da PI: 10.0778 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 90.1 | 1.1e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ien +nrqvt+skRr+g+ KKA+ELS+LCd+++a+i+fs++gkl y++
113962 9 KKIENATNRQVTYSKRRTGLVKKAYELSTLCDIDIALIMFSPSGKLTQYAT 59
78***********************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 28.777 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 2.7E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.57E-27 | 2 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.43E-32 | 2 | 65 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.0E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.7E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.0E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.0E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010152 | Biological Process | pollen maturation | ||||
| GO:0080092 | Biological Process | regulation of pollen tube growth | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 71 aa Download sequence Send to blast |
MGRVKLEIKK IENATNRQVT YSKRRTGLVK KAYELSTLCD IDIALIMFSP SGKLTQYATD 60 MRYLICLFIN * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 9e-20 | 1 | 61 | 1 | 62 | MEF2 CHIMERA |
| 6byy_B | 9e-20 | 1 | 61 | 1 | 62 | MEF2 CHIMERA |
| 6byy_C | 9e-20 | 1 | 61 | 1 | 62 | MEF2 CHIMERA |
| 6byy_D | 9e-20 | 1 | 61 | 1 | 62 | MEF2 CHIMERA |
| 6bz1_A | 8e-20 | 1 | 61 | 1 | 62 | MEF2 CHIMERA |
| 6bz1_B | 8e-20 | 1 | 61 | 1 | 62 | MEF2 CHIMERA |
| 6bz1_C | 8e-20 | 1 | 61 | 1 | 62 | MEF2 CHIMERA |
| 6bz1_D | 8e-20 | 1 | 61 | 1 | 62 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FM999805 | 1e-102 | Selaginella moellendorffii mRNA for MADS1 protein, allele 2 | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002981044.1 | 2e-36 | agamous-like MADS-box protein AGL3 | ||||
| Swissprot | Q9LM46 | 4e-27 | AG104_ARATH; Agamous-like MADS-box protein AGL104 | ||||
| TrEMBL | D8SCP2 | 5e-35 | D8SCP2_SELML; MADS-domain transcription factor | ||||
| TrEMBL | H1ZSL5 | 1e-36 | H1ZSL5_9TRAC; MADS1 protein (Fragment) | ||||
| STRING | EFJ17745 | 9e-36 | (Selaginella moellendorffii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP16 | 17 | 761 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G22130.1 | 2e-29 | AGAMOUS-like 104 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 113962 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




