PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information? help Back to Top

TF ID

11841

Common Name

MICPUCDRAFT_11841

Organism

Taxonomic ID

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas; Micromonas pusilla

Family

Protein Properties

Length: 57aa MW: 6509.33 Da PI: 4.4628

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
11841	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	40	9.4e-13	1	56	29	84
NF-YB 29 kdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplk 84 k+a + ec+ fi ++t+ a+d c+ kr+ti+ dd++ a+ +l f ++ epl+ 11841 1 KEALQAFSECAKIFIHYLTATANDICRDGKRQTISVDDVFKAIDELEFGEFSEPLR 56 57888999*********************************************996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	3.8E-21	1	56	IPR009072	Histone-fold
SuperFamily	SSF47113	1.0E-17	1	56	IPR009072	Histone-fold
Pfam	PF00808	5.4E-9	1	43	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 57 aa Download sequence Send to blast
KEALQAFSEC AKIFIHYLTA TANDICRDGK RQTISVDDVF KAIDELEFGE FSEPLRQ

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003054988.1	3e-35	predicted protein, partial
TrEMBL	C1MHN8	6e-34	C1MHN8_MICPC; Predicted protein (Fragment)
STRING	XP_003054988.1	1e-34	(Micromonas pusilla)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Chlorophytae	OGCP3453	13	13

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G27470.1	2e-24	nuclear factor Y, subunit B11

Link Out ? help Back to Top
Phytozome	11841
Entrez Gene	9681052

Publications ? help Back to Top
Worden AZ, et al. Green evolution and dynamic adaptations revealed by genomes of the marine picoeukaryotes Micromonas. Science, 2009. 324(5924): p. 268-72 [PMID:19359590]