PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

127390

Common Name

SELMODRAFT_127390

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

MYB_related

Protein Properties

Length: 68aa MW: 7521.75 Da PI: 8.3399

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
127390	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	33.2	1.2e-10	14	45	1	32
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 rg+WT eEd ll ++v+++G g+W+t + g 127390 14 RGPWTREEDTLLTQYVNEHGEGSWRTLPMAAG 45 89***********************9876655 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	2.0E-11	5	41	IPR009057	Homeodomain-like
SuperFamily	SSF46689	5.1E-9	8	45	IPR009057	Homeodomain-like
PROSITE profile	PS50090	7.085	9	40	IPR017877	Myb-like domain
Pfam	PF00249	3.0E-8	14	40	IPR001005	SANT/Myb domain
CDD	cd00167	9.03E-6	16	38	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 68 aa Download sequence Send to blast
MGRSPCCEKI GLNRGPWTRE EDTLLTQYVN EHGEGSWRTL PMAAGLIRPN LIPLLVSTFS 60 KIFCRGC*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor postulated to regulate the biosynthetic pathway of a flavonoid-derived pigment in certain floral tissues.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002988111.2	9e-26	myb-related protein 308
Swissprot	P27898	4e-18	MYBP_MAIZE; Myb-related protein P
TrEMBL	D8SXL9	2e-42	D8SXL9_SELML; Uncharacterized protein
STRING	EFJ10908	3e-43	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G49330.1	5e-20	myb domain protein 111

Link Out ? help Back to Top
Phytozome	127390
Entrez Gene	9657506

Publications ? help Back to Top
Robbins ML,Sekhon RS,Meeley R,Chopra S A Mutator transposon insertion is associated with ectopic expression of a tandemly repeated multicopy Myb gene pericarp color1 of maize. Genetics, 2008. 178(4): p. 1859-74 [PMID:18430921] Sidorenko L,Chandler V RNA-dependent RNA polymerase is required for enhancer-mediated transcriptional silencing associated with paramutation at the maize p1 gene. Genetics, 2008. 180(4): p. 1983-93 [PMID:18845841] Robbins ML,Wang P,Sekhon RS,Chopra S Gene structure induced epigenetic modifications of pericarp color1 alleles of maize result in tissue-specific mosaicism. PLoS ONE, 2009. 4(12): p. e8231 [PMID:20011605] Rhee Y,Sekhon RS,Chopra S,Kaeppler S Tissue culture-induced novel epialleles of a Myb transcription factor encoded by pericarp color1 in maize. Genetics, 2010. 186(3): p. 843-55 [PMID:20823340] Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Morohashi K, et al. A genome-wide regulatory framework identifies maize pericarp color1 controlled genes. Plant Cell, 2012. 24(7): p. 2745-64 [PMID:22822204]