PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information? help Back to Top

TF ID

130146

Organism

Taxonomic ID

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas; Micromonas pusilla

Family

Protein Properties

Length: 93aa MW: 10610.1 Da PI: 11.488

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
130146	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	38.1	3.5e-12	1	40	7	47
HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +Ed +l +v+ +G+++W+ Iar + R+ +c++rw + 130146 1 QEDARLTALVEAHGPRNWSFIARGLK-DRSSQSCRLRWCNQ 40 69*********************9.*********985 PP
2	Myb_DNA-binding	49.6	9.2e-16	47	90	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r+ +T+ E+ l+ a k+lG++ W++Ia+ ++ gRt++ +k+++++ 130146 47 RDTFTPAEERTLLAAYKKLGNR-WAAIAKVLP-GRTDNAVKNHLNS 90 789*****************.*****.********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
CDD	cd00167	3.13E-9	1	39	No hit	No description
Pfam	PF13921	1.2E-13	1	58	No hit	No description
PROSITE profile	PS51294	15.596	1	41	IPR017930	Myb domain
SMART	SM00717	8.1E-5	1	43	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.2E-19	1	48	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.8E-24	1	87	IPR009057	Homeodomain-like
PROSITE profile	PS51294	22.252	42	93	IPR017930	Myb domain
SMART	SM00717	6.9E-9	46	93	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	6.5E-19	49	92	IPR009057	Homeodomain-like
CDD	cd00167	9.05E-10	49	87	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 93 aa Download sequence Send to blast
QEDARLTALV EAHGPRNWSF IARGLKDRSS QSCRLRWCNQ LNPALRRDTF TPAEERTLLA 60 AYKKLGNRWA AIAKVLPGRT DNAVKNHLNS KLR

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Slightly induced by salicylic acid. {ECO:0000269\|PubMed:16463103}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002500273.1	3e-49	predicted protein, partial
Swissprot	Q42575	4e-34	MYB1_ARATH; Transcription factor MYB1
TrEMBL	C1DZ20	6e-48	C1DZ20_MICCC; Uncharacterized protein (Fragment)
STRING	XP_002500273.1	1e-48	(Micromonas sp. RCC299)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Chlorophytae	OGCP15	16	114

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G55730.1	8e-37	myb domain protein 109

Link Out ? help Back to Top
Phytozome	130146

Publications ? help Back to Top
Wang T, et al. Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1027-41 [PMID:26243618] Nguyen HT, et al. A Transcription Factor γMYB1 Binds to the P1BS cis-Element and Activates PLA2-γ Expression with its Co-Activator γMYB2. Plant Cell Physiol., 2016. 57(4): p. 784-97 [PMID:26872838] Sanz-Fernández M, et al. Screening Arabidopsis mutants in genes useful for phytoremediation. J. Hazard. Mater., 2017. 335: p. 143-151 [PMID:28441590] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]