PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

131666

Common Name

CDF1C-1, SELMODRAFT_448037

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

Dof

Protein Properties

Length: 67aa MW: 7839.96 Da PI: 10.6685

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
131666	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	121.7	2.6e-38	12	67	2	57
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrk 57 +ek ++cprC+s +tkfCy+nny+++qPr+fCk+C+ryWt+GG+lrnvPvG+grrk 131666 12 PEKPVSCPRCHSLDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTLRNVPVGAGRRK 67 68999**************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	2.0E-25	9	67	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	7.4E-32	14	67	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	27.969	16	67	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	18	54	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:1902455	Biological Process	negative regulation of stem cell population maintenance
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 67 aa Download sequence Send to blast
EDKRSGRPLK RPEKPVSCPR CHSLDTKFCY FNNYNVNQPR HFCKNCQRYW TAGGTLRNVP 60 VGAGRRK

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269\|PubMed:19619493}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00394	DAP	Transfer from AT3G47500	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269\|PubMed:19619493}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002990462.1	4e-44	cyclic dof factor 3
Swissprot	P68350	1e-32	DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBL	D8T4E1	9e-43	D8T4E1_SELML; Uncharacterized protein CDF1C-1
STRING	EFJ08555	1e-43	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP38	17	445

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G29160.1	6e-35	Dof family protein

Link Out ? help Back to Top
Phytozome	131666
Entrez Gene	9631237

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Bueso E, et al. Arabidopsis COGWHEEL1 links light perception and gibberellins with seed tolerance to deterioration. Plant J., 2016. 87(6): p. 583-96 [PMID:27227784]