![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 133654 | ||||||||
| Common Name | MICPUCDRAFT_8525 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas; Micromonas pusilla
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 98aa MW: 11653.5 Da PI: 11.3309 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 51.1 | 3.1e-16 | 1 | 44 | 4 | 48 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
WT +Ed l ++v ++G + W+ Ia++m+ gR +kqc++rw+++l
133654 1 WTLQEDNVLRKLVGEHGHRKWSFIASKMN-GRRGKQCRDRWLNHL 44
*****************************.*************97 PP
| |||||||
| 2 | Myb_DNA-binding | 53 | 7.7e-17 | 50 | 92 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
rg WT+eE+ +lv+++++lG++ W++ a+ ++ gR ++ +k++w+
133654 50 RGEWTAEEERILVEGHRMLGTR-WAALAKLLP-GRPENAIKNHWH 92
89********************.*********.***********8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 3.0E-26 | 1 | 51 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.83E-28 | 1 | 91 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.35E-11 | 1 | 44 | No hit | No description |
| SMART | SM00717 | 5.6E-11 | 1 | 46 | IPR001005 | SANT/Myb domain |
| PROSITE profile | PS51294 | 25.592 | 1 | 48 | IPR017930 | Myb domain |
| Pfam | PF13921 | 1.6E-18 | 1 | 58 | No hit | No description |
| PROSITE profile | PS51294 | 19.205 | 49 | 98 | IPR017930 | Myb domain |
| SMART | SM00717 | 3.5E-14 | 49 | 97 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 5.56E-9 | 52 | 95 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 9.4E-21 | 52 | 97 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 98 aa Download sequence Send to blast |
WTLQEDNVLR KLVGEHGHRK WSFIASKMNG RRGKQCRDRW LNHLKPDIRR GEWTAEEERI 60 LVEGHRMLGT RWAALAKLLP GRPENAIKNH WHATLRCK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1gv2_A | 7e-36 | 1 | 98 | 7 | 104 | MYB PROTO-ONCOGENE PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor required for female gametophyte fertility. Acts redundantly with MYB64 to initiate the FG5 transition during female gametophyte development. The FG5 transition represents the switch between free nuclear divisions and cellularization-differentiation in female gametophyte, and occurs during developmental stage FG5. {ECO:0000269|PubMed:24068955}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00567 | DAP | Transfer from AT5G58850 | Download |
| |||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | - | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003063222.1 | 3e-66 | predicted protein, partial | ||||
| Swissprot | Q9FIM4 | 5e-36 | MY119_ARATH; Transcription factor MYB119 | ||||
| TrEMBL | C1N5V5 | 6e-65 | C1N5V5_MICPC; Predicted protein (Fragment) | ||||
| STRING | XP_003063222.1 | 1e-65 | (Micromonas pusilla) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Chlorophytae | OGCP15 | 16 | 114 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G58850.1 | 2e-38 | myb domain protein 119 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 133654 |
| Entrez Gene | 9688870 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




