![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 17886 | ||||||||
| Common Name | bZIP, SELMODRAFT_17886 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 96aa MW: 11242.6 Da PI: 11.6524 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 46.3 | 9.3e-15 | 13 | 68 | 3 | 58 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58
++k+++r+ +NRe+ArrsR+RK++ +eeL+ L a+N+ +l+ +++ ++
17886 13 DDKKQKRMLSNRESARRSRLRKQQHMEELRSQLLDLRAQNSHILGKLSVASQQFSQ 68
68**************************************9877766666665555 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 2.3E-14 | 11 | 75 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 10.484 | 13 | 76 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 2.3E-11 | 13 | 68 | No hit | No description |
| Pfam | PF00170 | 2.6E-11 | 14 | 65 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 5.56E-12 | 15 | 66 | No hit | No description |
| CDD | cd14702 | 3.82E-12 | 16 | 67 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 18 | 33 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
STSEEDQQLR GVDDKKQKRM LSNRESARRS RLRKQQHMEE LRSQLLDLRA QNSHILGKLS 60 VASQQFSQIS HDNQLLRLQA SELGRQLQRL HRQASV |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 27 | 33 | RRSRLRK |
| 2 | 27 | 34 | RRSRLRKQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds to specific DNA sequences in target gene promoters. BZIP2-BZIP63-KIN10 complex binds to the ETFQO promoter to up-regulate its transcription (PubMed:29348240). {ECO:0000250|UniProtKB:O65683, ECO:0000269|PubMed:29348240}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00267 | DAP | Transfer from AT2G18160 | Download |
| |||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024542766.1 | 4e-59 | light-inducible protein CPRF2 | ||||
| Swissprot | Q9SI15 | 3e-17 | BZIP2_ARATH; bZIP transcription factor 2 | ||||
| TrEMBL | D8SEW8 | 7e-58 | D8SEW8_SELML; Uncharacterized protein bZIP (Fragment) | ||||
| STRING | EFJ17051 | 1e-58 | (Selaginella moellendorffii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP551 | 16 | 78 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G18160.1 | 1e-19 | basic leucine-zipper 2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 17886 |
| Entrez Gene | 9634578 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




