PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

18217

Common Name

SELMODRAFT_18216, SELMODRAFT_18217

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

HD-ZIP

Protein Properties

Length: 87aa MW: 10372.9 Da PI: 10.5808

Description

HD-ZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
18217	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	59.4	5.9e-19	6	59	3	56
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 k+++++ eq++ Le Fe ++ + ++ +LA++lgL+ rqV vWFqNrRa++k 18217 6 KKRRLSVEQVRSLELSFETENRLEPVRKMQLAQELGLQPRQVAVWFQNRRARWK 59 56689************************************************9 PP
2	HD-ZIP_I/II	127.3	6.6e-41	5	86	1	82
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLek 82 ekkrrls eqv++LE sFe+e++Lep rK++la+eLglqprqvavWFqnrRAR+ktkqlEkdy++Lk+ay++l+een+rL++ 18217 5 EKKRRLSVEQVRSLELSFETENRLEPVRKMQLAQELGLQPRQVAVWFQNRRARWKTKQLEKDYDVLKAAYESLAEENKRLKA 86 69******************************************************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50071	16.487	1	61	IPR001356	Homeobox domain
SMART	SM00389	7.5E-17	4	65	IPR001356	Homeobox domain
Pfam	PF00046	4.6E-16	6	59	IPR001356	Homeobox domain
SuperFamily	SSF46689	9.8E-19	6	70	IPR009057	Homeodomain-like
CDD	cd00086	6.94E-12	6	62	No hit	No description
Gene3D	G3DSA:1.10.10.60	8.3E-21	8	69	IPR009057	Homeodomain-like
PRINTS	PR00031	8.9E-7	32	41	IPR000047	Helix-turn-helix motif
PROSITE pattern	PS00027	0	36	59	IPR017970	Homeobox, conserved site
PRINTS	PR00031	8.9E-7	41	57	IPR000047	Helix-turn-helix motif
Pfam	PF02183	5.1E-9	61	87	IPR003106	Leucine zipper, homeobox-associated

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 87 aa Download sequence Send to blast
GGFPEKKRRL SVEQVRSLEL SFETENRLEP VRKMQLAQEL GLQPRQVAVW FQNRRARWKT 60 KQLEKDYDVL KAAYESLAEE NKRLKAQ

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	53	61	RRARWKTKQ

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription activator involved in leaf development. Binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. {ECO:0000269\|PubMed:8535134}.
UniProt	Probable transcription factor that may function as a negative regulator of the flowering time response to photoperiod. May act to repress cell expansion during plant development. {ECO:0000269\|PubMed:14623244}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002990005.2	9e-55	homeobox-leucine zipper protein HOX22 isoform X2
Refseq	XP_024519445.1	8e-55	homeobox-leucine zipper protein HOX22 isoform X1
Swissprot	Q02283	6e-35	HAT5_ARATH; Homeobox-leucine zipper protein HAT5
Swissprot	Q940J1	9e-35	ATB16_ARATH; Homeobox-leucine zipper protein ATHB-16
TrEMBL	D8RC65	8e-55	D8RC65_SELML; Uncharacterized protein (Fragment)
STRING	EFJ09018	1e-55	(Selaginella moellendorffii)
STRING	EFJ30074	1e-55	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP129	16	189

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G01470.1	2e-37	homeobox 1

Link Out ? help Back to Top
Phytozome	18217
Entrez Gene	9630347 \| 9650795

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Ribone PA,Capella M,Arce AL,Chan RL A uORF Represses the Transcription Factor AtHB1 in Aerial Tissues to Avoid a Deleterious Phenotype. Plant Physiol., 2017. 175(3): p. 1238-1253 [PMID:28956754]