PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

19595

Common Name

LEC1-1, LEC1-2, LEC1A1, LEC1A2, SELMODRAFT_450067, SELMODRAFT_450069

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

NF-YB

Protein Properties

Length: 90aa MW: 10535.1 Da PI: 6.5154

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
19595	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	169.1	5.3e-53	1	90	2	91
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 reqdrf+Pianv+rim+kvlPa+akis+daket+qecvsefisf+tsea+dkcqre+rkti+++dllwa+++lGf+dy++pl+++l+kyr 19595 1 REQDRFMPIANVIRIMRKVLPAHAKISDDAKETIQECVSEFISFITSEANDKCQREQRKTITAEDLLWAMSKLGFDDYADPLSLFLHKYR 90 79***************************************************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.5E-47	1	90	IPR009072	Histone-fold
SuperFamily	SSF47113	6.83E-37	3	90	IPR009072	Histone-fold
Pfam	PF00808	2.1E-27	6	70	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	3.9E-18	34	52	No hit	No description
PROSITE pattern	PS00685	0	37	53	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	3.9E-18	53	71	No hit	No description
PRINTS	PR00615	3.9E-18	72	90	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009738	Biological Process	abscisic acid-activated signaling pathway
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0033613	Molecular Function	activating transcription factor binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 90 aa Download sequence Send to blast
REQDRFMPIA NVIRIMRKVL PAHAKISDDA KETIQECVSE FISFITSEAN DKCQREQRKT 60 ITAEDLLWAM SKLGFDDYAD PLSLFLHKYR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5g49_A	3e-57	1	90	7	96	NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269\|PubMed:12509518, ECO:0000269\|PubMed:17322342}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU019906	1e-152	Selaginella moellendorffii CCAAT-box binding factor HAP3-like protein (LEC1A2) mRNA, partial cds

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002969299.1	5e-62	nuclear transcription factor Y subunit B-9
Refseq	XP_002986815.2	8e-62	nuclear transcription factor Y subunit B-3
Swissprot	Q84W66	2e-56	NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBL	D8RE70	1e-60	D8RE70_SELML; CCAAT-box binding factor HAP3-like protein
STRING	EFJ12145	2e-61	(Selaginella moellendorffii)
STRING	EFJ29387	2e-61	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP168	17	170

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G47670.2	7e-59	nuclear factor Y, subunit B6

Link Out ? help Back to Top
Phytozome	19595
Entrez Gene	9660315 \| 9662609

Publications ? help Back to Top
Xie Z, et al. Duplication and functional diversification of HAP3 genes leading to the origin of the seed-developmental regulatory gene, LEAFY COTYLEDON1 (LEC1), in nonseed plant genomes. Mol. Biol. Evol., 2008. 25(8): p. 1581-92 [PMID:18453547] Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Jia H,McCarty DR,Suzuki M Distinct roles of LAFL network genes in promoting the embryonic seedling fate in the absence of VAL repression. Plant Physiol., 2013. 163(3): p. 1293-305 [PMID:24043445] Kim HU, et al. Ectopic overexpression of castor bean LEAFY COTYLEDON2 (LEC2) in Arabidopsis triggers the expression of genes that encode regulators of seed maturation and oil body proteins in vegetative tissues. FEBS Open Bio, 2013. 4: p. 25-32 [PMID:24363987] Gnesutta N,Saad D,Chaves-Sanjuan A,Mantovani R,Nardini M Crystal Structure of the Arabidopsis thaliana L1L/NF-YC3 Histone-fold Dimer Reveals Specificities of the LEC1 Family of NF-Y Subunits in Plants. Mol Plant, 2017. 10(4): p. 645-648 [PMID:27871811] Li D, et al. MYB89 Transcription Factor Represses Seed Oil Accumulation. Plant Physiol., 2017. 173(2): p. 1211-1225 [PMID:27932421] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722] Han JD, et al. Evolutionary Analysis of the LAFL Genes Involved in the Land Plant Seed Maturation Program. Front Plant Sci, 2017. 8: p. 439 [PMID:28421087]