PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

19630

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

Dof

Protein Properties

Length: 59aa MW: 6880 Da PI: 10.5282

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
19630	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	124.6	3.2e-39	4	59	2	57
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrk 57 +++ lkcprC+s ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk 19630 4 PNQVLKCPRCNSLNTKFCYYNNYSLTQPRHFCKNCRRYWTKGGALRNVPIGGGCRK 59 78999**************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	2.0E-24	2	59	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	1.4E-33	6	59	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	29.059	8	59	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	10	46	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 59 aa Download sequence Send to blast
KPQPNQVLKC PRCNSLNTKF CYYNNYSLTQ PRHFCKNCRR YWTKGGALRN VPIGGGCRK

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00570	DAP	Transfer from AT5G60850	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024536180.1	6e-39	dof zinc finger protein DOF2.4-like, partial
Refseq	XP_024539523.1	6e-39	dof zinc finger protein DOF2.4-like, partial
Swissprot	Q8LDR0	1e-31	DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBL	D8R3A8	7e-33	D8R3A8_SELML; Uncharacterized protein
TrEMBL	D8RWQ9	2e-35	D8RWQ9_SELML; Uncharacterized protein (Fragment)
STRING	EFJ20302	3e-36	(Selaginella moellendorffii)
STRING	EFJ23299	3e-36	(Selaginella moellendorffii)
STRING	EFJ33243	1e-33	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP38	17	445

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60850.1	6e-34	OBF binding protein 4

Link Out ? help Back to Top
Phytozome	19630

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Xu P,Chen H,Ying L,Cai W AtDOF5.4/OBP4, a DOF Transcription Factor Gene that Negatively Regulates Cell Cycle Progression and Cell Expansion in Arabidopsis thaliana. Sci Rep, 2016. 6: p. 27705 [PMID:27297966] Ramirez-Parra E, et al. The transcription factor OBP4 controls root growth and promotes callus formation. New Phytol., 2017. 213(4): p. 1787-1801 [PMID:27859363] Rymen B, et al. ABA Suppresses Root Hair Growth via the OBP4 Transcriptional Regulator. Plant Physiol., 2017. 173(3): p. 1750-1762 [PMID:28167701]