PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

19631

Common Name

SELMODRAFT_19631

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

Dof

Protein Properties

Length: 59aa MW: 7039.05 Da PI: 10.3127

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
19631	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	68.3	1.2e-21	11	59	2	50
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvP 50 e+ +kcprC+s +tkfCy nn sqPry C +C+r +tkGG +r vP 19631 11 DEELTKCPRCNSLDTKFCYNNNKKASQPRYRCNSCKRKFTKGGRIRFVP 59 57889*****************************************999 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	6.0E-11	5	59	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	6.5E-22	13	59	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	19.796	15	59	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 59 aa Download sequence Send to blast
QKYQSQNKCQ DEELTKCPRC NSLDTKFCYN NNKKASQPRY RCNSCKRKFT KGGRIRFVP

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250\|UniProtKB:Q6K537}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020571739.1	8e-15	dof zinc finger protein DOF3.1-like
Refseq	XP_024536180.1	2e-14	dof zinc finger protein DOF2.4-like, partial
Refseq	XP_024539523.1	2e-14	dof zinc finger protein DOF2.4-like, partial
Swissprot	Q9SXG8	4e-15	DOF1_ORYSJ; Dof zinc finger protein 1
TrEMBL	D8T339	1e-34	D8T339_SELML; Uncharacterized protein (Fragment)
STRING	EFJ08958	2e-35	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP38	17	445

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G65590.1	2e-16	Dof family protein

Link Out ? help Back to Top
Phytozome	19631
Entrez Gene	9630363

Publications ? help Back to Top
Washio K Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains. Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62 [PMID:11470159] Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031]