PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 19631
Common NameSELMODRAFT_19631
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family Dof
Protein Properties Length: 59aa    MW: 7039.05 Da    PI: 10.3127
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
19631genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof68.31.2e-211159250
  zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvP 50
             e+ +kcprC+s +tkfCy nn   sqPry C +C+r +tkGG +r vP
   19631 11 DEELTKCPRCNSLDTKFCYNNNKKASQPRYRCNSCKRKFTKGGRIRFVP 59
            57889*****************************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-11559IPR003851Zinc finger, Dof-type
PfamPF027016.5E-221359IPR003851Zinc finger, Dof-type
PROSITE profilePS5088419.7961559IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 59 aa     Download sequence    Send to blast
QKYQSQNKCQ DEELTKCPRC NSLDTKFCYN NNKKASQPRY RCNSCKRKFT KGGRIRFVP
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020571739.18e-15dof zinc finger protein DOF3.1-like
RefseqXP_024536180.12e-14dof zinc finger protein DOF2.4-like, partial
RefseqXP_024539523.12e-14dof zinc finger protein DOF2.4-like, partial
SwissprotQ9SXG84e-15DOF1_ORYSJ; Dof zinc finger protein 1
TrEMBLD8T3391e-34D8T339_SELML; Uncharacterized protein (Fragment)
STRINGEFJ089582e-35(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.12e-16Dof family protein
Publications ? help Back to Top
  1. Washio K
    Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains.
    Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62
    [PMID:11470159]
  2. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]