![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 19633 | ||||||||
| Common Name | SELMODRAFT_19633 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 59aa MW: 7034.96 Da PI: 9.972 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 66.2 | 5.5e-21 | 12 | 59 | 3 | 50 |
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvP 50
e+ + cprC s +tkfCy nn sqPry C +C+r +tkGG +r vP
19633 12 EEPTICPRCSSIDTKFCYNNNKKASQPRYRCNSCKRKFTKGGRIRFVP 59
67889****************************************999 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 2.0E-10 | 10 | 59 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 2.5E-21 | 14 | 59 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 19.489 | 15 | 59 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 59 aa Download sequence Send to blast |
QEYNSQHKFQ DEEPTICPRC SSIDTKFCYN NNKKASQPRY RCNSCKRKFT KGGRIRFVP |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Promotes expression (PubMed:19915089). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Involved in the regulation of interfascicular cambium formation and vascular tissue development, particularly at a very early stage during inflorescence stem development; promotes both cambium activity and phloem specification, but prevents xylem specification (PubMed:19915089). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:19915089, ECO:0000269|PubMed:30626969}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004953626.1 | 1e-14 | dof zinc finger protein 1 | ||||
| Refseq | XP_016745239.1 | 8e-15 | PREDICTED: dof zinc finger protein DOF2.1-like | ||||
| Swissprot | Q9FM03 | 2e-13 | DOF56_ARATH; Dof zinc finger protein DOF5.6 | ||||
| TrEMBL | D8SIS9 | 1e-35 | D8SIS9_SELML; Uncharacterized protein (Fragment) | ||||
| STRING | EFJ15677 | 2e-36 | (Selaginella moellendorffii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP38 | 17 | 445 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G62940.1 | 9e-16 | Dof family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 19633 |
| Entrez Gene | 9654468 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




