PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

28161.m000225

Common Name

RCOM_0178310

Organism

Ricinus communis

Taxonomic ID

3988

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus

Family

MYB_related

Protein Properties

Length: 56aa MW: 6036.9 Da PI: 8.8114

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
28161.m000225	genome	JCVI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	37.5	5.6e-12	14	45	1	32
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g+WT+eEd++lv+ ++ +G g+W++ ++ g 28161.m000225 14 KGPWTPEEDQKLVKHIQTHGHGSWRALPKLAG 45 79***************************999 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	11.895	9	56	IPR017930	Myb domain
SuperFamily	SSF46689	9.33E-10	11	43	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	4.0E-14	12	45	IPR009057	Homeodomain-like
Pfam	PF00249	4.1E-10	14	46	IPR001005	SANT/Myb domain
CDD	cd00167	1.53E-7	16	46	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 56 aa Download sequence Send to blast
MGRSPCCDES GLKKGPWTPE EDQKLVKHIQ THGHGSWRAL PKLAGTVLTD VGRVAG

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269\|PubMed:24902892}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	28161.m000225

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269\|PubMed:24902892}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KM034725	4e-41	KM034725.1 Jatropha curcas clone JcMYB105 MYB family protein gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022133092.1	6e-27	transcription factor MYB41-like
Swissprot	Q9S9Z2	1e-23	MYB93_ARATH; Transcription factor MYB93
TrEMBL	B9T3L7	2e-33	B9T3L7_RICCO; R2r3-myb transcription factor, putative
STRING	XP_002532836.1	4e-34	(Ricinus communis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G02940.1	7e-27	myb domain protein 107

Link Out ? help Back to Top
Phytozome	28161.m000225

Publications ? help Back to Top
Gibbs DJ,Coates JC AtMYB93 is an endodermis-specific transcriptional regulator of lateral root development in arabidopsis. Plant Signal Behav, 2014. 9(10): p. e970406 [PMID:25482809]