PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28281.m000379
Common NameRCOM_0213350
Organism
Ricinus communis
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family CAMTA
Protein Properties Length: 148aa    MW: 17763.1 Da    PI: 9.6717
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28281.m000379genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1163.34.4e-51201232105
           CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrr 97 
                    ++ ++rwl++ ei++iL n++k++++ e+++ p+sgsl+L++rk++ryfrkDG++w+kkkdgktv+E+he+LK g+++vl+cyYah+een++fqrr
  28281.m000379  20 VEAQHRWLRPAEICEILRNYNKFRIAPEPAHLPSSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKSGSIDVLHCYYAHGEENENFQRR 115
                    6779******************************************************************************************** PP

           CG-1  98 cywlLeee 105
                    +yw+Lee 
  28281.m000379 116 SYWMLEEF 123
                    *****985 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143771.20415146IPR005559CG-1 DNA-binding domain
SMARTSM010768.1E-6018142IPR005559CG-1 DNA-binding domain
PfamPF038591.4E-4321122IPR005559CG-1 DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MAEARRHPLG NQLDIQQILV EAQHRWLRPA EICEILRNYN KFRIAPEPAH LPSSGSLFLF  60
DRKVLRYFRK DGHNWRKKKD GKTVKEAHER LKSGSIDVLH CYYAHGEENE NFQRRSYWML  120
EEFFLHNKQE NNSFKHDFLN TLGDKEGR
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3'. Binds calmodulin in a calcium-dependent manner in vitro (PubMed:12218065). Regulates transcriptional activity in response to calcium signals (Probable). Involved in freezing tolerance in association with CAMTA1 and CAMTA2 (PubMed:23581962). Required for the cold-induced expression of DREB1B/CBF1, DREB1C/CBF2, ZAT12 and GOLS3 (PubMed:19270186). Involved in response to cold. Contributes together with CAMTA5 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:28351986). Involved together with CAMTA2 and CAMTA4 in the positive regulation of a general stress response (GSR) (PubMed:25039701). Involved in the regulation of GSR amplitude downstream of MEKK1 (PubMed:25157030). Involved in the regulation of a set of genes involved in defense responses against pathogens (PubMed:18298954). Involved in the regulation of both basal resistance and systemic acquired resistance (SAR) (PubMed:21900483). Acts as negative regulator of plant immunity (PubMed:19122675, PubMed:21900483, PubMed:22345509, PubMed:28407487). Binds to the promoter of the defense-related gene EDS1 and represses its expression (PubMed:19122675). Binds to the promoter of the defense-related gene NDR1 and represses its expression (PubMed:22345509). Involved in defense against insects (PubMed:23072934, PubMed:22371088). Required for tolerance to the generalist herbivore Trichoplusia ni, and contributes to the positive regulation of genes associated with glucosinolate metabolism (PubMed:23072934). Required for tolerance to Bradysia impatiens larvae. Mediates herbivore-induced wound response (PubMed:22371088). Required for wound-induced jasmonate accumulation (PubMed:23072934, PubMed:22371088). Involved in the regulation of ethylene-induced senescence by binding to the promoter of the senescence-inducer gene EIN3 and repressing its expression (PubMed:22345509). {ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:18298954, ECO:0000269|PubMed:19122675, ECO:0000269|PubMed:19270186, ECO:0000269|PubMed:21900483, ECO:0000269|PubMed:22345509, ECO:0000269|PubMed:22371088, ECO:0000269|PubMed:23072934, ECO:0000269|PubMed:23581962, ECO:0000269|PubMed:25039701, ECO:0000269|PubMed:25157030, ECO:0000269|PubMed:28351986, ECO:0000269|PubMed:28407487, ECO:0000305|PubMed:11925432}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap28281.m000379
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By heat shock, UVB, salt, wounding, ethylene and methyl jasmonate (PubMed:11162426, PubMed:12218065). Induced by infection with the fungal pathogen Golovinomyces cichoracearum (powdery mildew) and the bacterial pathogen Pseudomonas syringae pv tomato strain DC3000 (PubMed:22345509). {ECO:0000269|PubMed:11162426, ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:22345509}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4345403e-38AM434540.2 Vitis vinifera contig VV78X210461.8, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015582144.12e-81calmodulin-binding transcription activator 3
SwissprotQ8GSA79e-64CMTA3_ARATH; Calmodulin-binding transcription activator 3
TrEMBLB9SZ481e-107B9SZ48_RICCO; Calmodulin-binding transcription activator (Camta), plants, putative
STRINGXP_002531267.11e-107(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF142411819
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22300.24e-66signal responsive 1
Publications ? help Back to Top
  1. Zhang L,Du L,Shen C,Yang Y,Poovaiah BW
    Regulation of plant immunity through ubiquitin-mediated modulation of Ca(2+) -calmodulin-AtSR1/CAMTA3 signaling.
    Plant J., 2014. 78(2): p. 269-81
    [PMID:24528504]
  2. Benn G, et al.
    A key general stress response motif is regulated non-uniformly by CAMTA transcription factors.
    Plant J., 2014. 80(1): p. 82-92
    [PMID:25039701]
  3. Rahman H,Yang J,Xu YP,Munyampundu JP,Cai XZ
    Phylogeny of Plant CAMTAs and Role of AtCAMTAs in Nonhost Resistance to Xanthomonas oryzae pv. oryzae.
    Front Plant Sci, 2016. 7: p. 177
    [PMID:26973658]
  4. Benn G, et al.
    Plastidial metabolite MEcPP induces a transcriptionally centered stress-response hub via the transcription factor CAMTA3.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(31): p. 8855-60
    [PMID:27432993]
  5. Kidokoro S, et al.
    Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature.
    Plant Cell, 2017. 29(4): p. 760-774
    [PMID:28351986]
  6. Lolle S, et al.
    Matching NLR Immune Receptors to Autoimmunity in camta3 Mutants Using Antimorphic NLR Alleles.
    Cell Host Microbe, 2017. 21(4): p. 518-529.e4
    [PMID:28407487]
  7. Kim YS, et al.
    CAMTA-Mediated Regulation of Salicylic Acid Immunity Pathway Genes in Arabidopsis Exposed to Low Temperature and Pathogen Infection.
    Plant Cell, 2017. 29(10): p. 2465-2477
    [PMID:28982964]
  8. Jacob F, et al.
    A dominant-interfering camta3 mutation compromises primary transcriptional outputs mediated by both cell surface and intracellular immune receptors in Arabidopsis thaliana.
    New Phytol., 2018. 217(4): p. 1667-1680
    [PMID:29226970]