PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

28626

Common Name

SELMODRAFT_28625, SELMODRAFT_28626

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

SBP

Protein Properties

Length: 83aa MW: 9450.74 Da PI: 11.0362

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
28626	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	131.4	3.1e-41	9	83	1	75
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75 +Cqv+gC adls k yhrrh+vCe hskap+ +v+g+eqrfCqqCsrfh l fDe+krsCrrrLa+hn+rrrk 28626 9 RCQVDGCGADLSGSKGYHRRHRVCELHSKAPKSIVKGQEQRFCQQCSRFHGLGYFDEGKRSCRRRLAGHNQRRRK 83 6*************************************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	4.3E-36	3	71	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	32.394	7	83	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	1.22E-37	8	83	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	4.3E-33	10	83	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 83 aa Download sequence Send to blast
VAQPAATPRC QVDGCGADLS GSKGYHRRHR VCELHSKAPK SIVKGQEQRF CQQCSRFHGL 60 GYFDEGKRSC RRRLAGHNQR RRK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	1e-31	10	83	11	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269\|PubMed:15703061}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002962307.2	1e-54	squamosa promoter-binding-like protein 14
Refseq	XP_002965226.2	2e-53	uncharacterized protein LOC9660230
Swissprot	Q8RY95	9e-35	SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBL	D8QT82	4e-53	D8QT82_SELML; Uncharacterized protein (Fragment)
STRING	EFJ34064	6e-54	(Selaginella moellendorffii)
STRING	EFJ37567	6e-54	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP97	17	230

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G20980.1	4e-37	squamosa promoter binding protein-like 14

Link Out ? help Back to Top
Phytozome	28626
Entrez Gene	9647112 \| 9660230

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Jorgensen SA,Preston JC Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis. Mol. Phylogenet. Evol., 2014. 73: p. 129-39 [PMID:24508602] Liu J, et al. Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.). Front Plant Sci, 2016. 7: p. 21 [PMID:26870051]