PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

28630

Common Name

SELMODRAFT_17706, SELMODRAFT_28630

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

SBP

Protein Properties

Length: 80aa MW: 9353.68 Da PI: 10.899

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
28630	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	133.8	5.5e-42	6	80	1	75
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75 +Cqv+gC+adls+ak+yhrrhkvCe+hskap+v+++ ++qrfCqqCsrfh lsefD++krsCr+rLa+hn+rrrk 28630 6 MCQVQGCAADLSKAKHYHRRHKVCEIHSKAPNVIANAQTQRFCQQCSRFHPLSEFDDTKRSCRKRLADHNRRRRK 80 6*************************************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	1.4E-35	3	68	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	31.744	4	80	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	1.27E-37	5	80	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	3.1E-33	7	80	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 80 aa Download sequence Send to blast
GTHAPMCQVQ GCAADLSKAK HYHRRHKVCE IHSKAPNVIA NAQTQRFCQQ CSRFHPLSEF 60 DDTKRSCRKR LADHNRRRRK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	9e-32	6	80	10	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. Binds specifically to the 5'-GTAC-3' core sequence. Involved in development and floral organogenesis. Required for ovule differentiation, pollen production, filament elongation, seed formation and siliques elongation. Also seems to play a role in the formation of trichomes on sepals. May positively modulate gibberellin (GA) signaling in flower. {ECO:0000269\|PubMed:12671094, ECO:0000269\|PubMed:16095614, ECO:0000269\|PubMed:17093870}.
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269\|PubMed:15703061}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002969457.2	3e-51	uncharacterized protein LOC9659205
Swissprot	Q8GXL3	3e-36	SPL8_ARATH; Squamosa promoter-binding-like protein 8
Swissprot	Q8RY95	8e-35	SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBL	D8QNH9	6e-52	D8QNH9_SELML; Uncharacterized protein (Fragment)
STRING	EFJ29545	1e-52	(Selaginella moellendorffii)
STRING	EFJ38765	1e-52	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP97	17	230

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G02065.1	1e-38	squamosa promoter binding protein-like 8

Link Out ? help Back to Top
Phytozome	28630
Entrez Gene	9632735 \| 9659205

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Jorgensen SA,Preston JC Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis. Mol. Phylogenet. Evol., 2014. 73: p. 129-39 [PMID:24508602] Liu J, et al. Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.). Front Plant Sci, 2016. 7: p. 21 [PMID:26870051] Xing S, et al. SPL8 Acts Together with the Brassinosteroid-Signaling Component BIM1 in Controlling Arabidopsis thaliana Male Fertility. Plants (Basel), 2013. 2(3): p. 416-28 [PMID:27137384]