PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28635
Common NameSELMODRAFT_28634, SELMODRAFT_28635
Organism
Selaginella moellendorffii
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family SBP
Protein Properties Length: 78aa    MW: 9079.34 Da    PI: 10.2329
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28635genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP137.73.5e-43277176
           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
    SBP  1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76
           +CqvegC +dl   k yhrrh+vCevhsk+p+ +v+g+e+rfCqqCsrfh l+efD++krsCr+rLa+hnerrrk+
  28635  2 VCQVEGCGTDLRGSKGYHRRHRVCEVHSKTPKSVVDGIEKRFCQQCSRFHVLEEFDDGKRSCRKRLAGHNERRRKP 77
           6*************************************************************************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.1E-34164IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.65177IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.29E-39177IPR004333Transcription factor, SBP-box
PfamPF031102.2E-33376IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 78 aa     Download sequence    Send to blast
PVCQVEGCGT DLRGSKGYHR RHRVCEVHSK TPKSVVDGIE KRFCQQCSRF HVLEEFDDGK  60
RSCRKRLAGH NERRRKPT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-312761084squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002965229.27e-51squamosa promoter-binding-like protein 14
SwissprotQ94JW82e-37SPL6_ARATH; Squamosa promoter-binding-like protein 6
TrEMBLD8QT903e-49D8QT90_SELML; Uncharacterized protein (Fragment)
STRINGEFJ340674e-50(Selaginella moellendorffii)
STRINGEFJ375714e-50(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.16e-40SBP family protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]
  2. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  3. Xu M, et al.
    Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(8): p. e1006263
    [PMID:27541584]