PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

28794

Common Name

SELMODRAFT_7330

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

TCP

Protein Properties

Length: 50aa MW: 5706.55 Da PI: 10.161

Description

TCP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
28794	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	TCP	88.3	1.7e-27	1	50	13	62
TCP 13 TkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikel 62 T++g+RdRRvRls+ +a++f+d+qd+LG+d++sk++eWLl++ak+ai++l 28794 1 TSKGLRDRRVRLSVATAIQFYDVQDRLGYDQPSKAVEWLLKKAKAAIDDL 50 99*********************************************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03634	5.8E-25	1	50	IPR005333	Transcription factor, TCP
PROSITE profile	PS51369	28.341	1	50	IPR017887	Transcription factor TCP subgroup

Sequence ? help Back to Top
Protein Sequence Length: 50 aa Download sequence Send to blast
TSKGLRDRRV RLSVATAIQF YDVQDRLGYD QPSKAVEWLL KKAKAAIDDL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5zkt_A	1e-22	1	50	5	54	Putative transcription factor PCF6
5zkt_B	1e-22	1	50	5	54	Putative transcription factor PCF6
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). {ECO:0000269\|PubMed:17307931, ECO:0000269\|PubMed:25378179}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024522990.1	4e-26	uncharacterized protein LOC112343562
Refseq	XP_024522991.1	4e-26	uncharacterized protein LOC112343562
Refseq	XP_024522992.1	4e-26	uncharacterized protein LOC112343562
Refseq	XP_024522993.1	4e-26	uncharacterized protein LOC112343562
Swissprot	O82277	4e-23	TCP10_ARATH; Transcription factor TCP10
TrEMBL	D8RQ84	5e-27	D8RQ84_SELML; Uncharacterized protein (Fragment)
TrEMBL	D8TDH0	5e-27	D8TDH0_SELML; Uncharacterized protein (Fragment)
STRING	EFJ05334	8e-28	(Selaginella moellendorffii)
STRING	EFJ25614	8e-28	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP180	15	163

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G31070.1	1e-25	TCP domain protein 10

Link Out ? help Back to Top
Phytozome	28794
Entrez Gene	9663460

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549] Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development. Plant Physiol., 2018. 176(2): p. 1694-1708 [PMID:29133375]