PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29247
Common NameSELMODRAFT_18136, WRKY_29
Organism
Selaginella moellendorffii
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family WRKY
Protein Properties Length: 80aa    MW: 9539.81 Da    PI: 10.4529
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29247genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.21.7e-332380158
           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
   WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58
           +dDgy+WrKYGqK vk+s++prsYYrCt ++Cpvkk+vers+ed+ +v++tYeg Hnh
  29247 23 MDDGYRWRKYGQKAVKNSPHPRSYYRCTNTKCPVKKRVERSSEDQGLVITTYEGIHNH 80
           69*******************************************************9 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.0E-35880IPR003657WRKY domain
SuperFamilySSF1182902.75E-301580IPR003657WRKY domain
PROSITE profilePS5081131.0541880IPR003657WRKY domain
SMARTSM007741.0E-342380IPR003657WRKY domain
PfamPF031064.4E-272480IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
KKGQKRIREP RYAIQTRSEV DIMDDGYRWR KYGQKAVKNS PHPRSYYRCT NTKCPVKKRV  60
ERSSEDQGLV ITTYEGIHNH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-291180271WRKY transcription factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002972266.21e-47probable WRKY transcription factor 23 isoform X2
RefseqXP_002984180.21e-47probable WRKY transcription factor 23 isoform X1
RefseqXP_024532948.11e-47probable WRKY transcription factor 23 isoform X1
RefseqXP_024545124.11e-47probable WRKY transcription factor 23 isoform X2
SwissprotQ9C9836e-39WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBLD8SLN21e-52D8SLN2_SELML; Uncharacterized protein WRKY_29 (Fragment)
STRINGEFJ146902e-53(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.22e-41WRKY DNA-binding protein 57
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Jiang Y,Qiu Y,Hu Y,Yu D
    Heterologous Expression of AtWRKY57 Confers Drought Tolerance in Oryza sativa.
    Front Plant Sci, 2016. 7: p. 145
    [PMID:26904091]
  4. Jiang Y,Yu D
    The WRKY57 Transcription Factor Affects the Expression of Jasmonate ZIM-Domain Genes Transcriptionally to Compromise Botrytis cinerea Resistance.
    Plant Physiol., 2016. 171(4): p. 2771-82
    [PMID:27268959]
  5. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]