PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29278.m000136
Common NameRCOM_0415140
Organism
Ricinus communis
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family MYB_related
Protein Properties Length: 57aa    MW: 6703.61 Da    PI: 9.2526
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29278.m000136genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.31.5e-121445132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     rg WT+eEd +l  +++q+G+++W++I++  g
    29278.m000136 14 RGQWTPEEDNKLSSYIAQHGTRNWRLIPKNAG 45
                     89**************************9988 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.4E-14543IPR009057Homeodomain-like
SuperFamilySSF466898.61E-10843IPR009057Homeodomain-like
PROSITE profilePS5129413.956957IPR017930Myb domain
PfamPF002491.2E-101445IPR001005SANT/Myb domain
CDDcd001672.05E-71748No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 57 aa     Download sequence    Send to blast
MGRIPCCEKD NVKRGQWTPE EDNKLSSYIA QHGTRNWRLI PKNAGSFTNF LSYMIHY
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the DNA sequence 5'-CCAACC-3'. Regulates directly PME5, UND and GLOX1 (PubMed:21673079). Essential for tapetum development in anthers and microsporogenesis (PubMed:12848824, PubMed:21673079). Regulates the timing of tapetal programmed cell death (PCD) which is critical for pollen development. May act through the activation of UND, encoding an A1 aspartic protease (PubMed:21673079). Required for anther development by regulating tapetum development, callose dissolution and exine formation. Acts upstream of A6 and FAR2/MS2, two genes required for pollen exine formation (PubMed:17727613). Negatively regulates trichome endoreduplication and trichome branching (PubMed:12848824). {ECO:0000269|PubMed:12848824, ECO:0000269|PubMed:17727613, ECO:0000269|PubMed:21673079}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap29278.m000136
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0347412e-43KM034741.1 Jatropha curcas clone JcMYB122 MYB family protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020264293.14e-27transcription factor MYB80
SwissprotQ9XHV05e-26MYB80_ARATH; Transcription factor MYB80
TrEMBLB9T6571e-36B9T657_RICCO; Uncharacterized protein
STRINGXP_002533726.12e-37(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.12e-28myb domain protein 103
Publications ? help Back to Top
  1. Li SF,Iacuone S,Parish RW
    Suppression and restoration of male fertility using a transcription factor.
    Plant Biotechnol. J., 2007. 5(2): p. 297-312
    [PMID:17309685]
  2. Qian H, et al.
    Trace concentrations of imazethapyr (IM) affect floral organs development and reproduction in Arabidopsis thaliana: IM-induced inhibition of key genes regulating anther and pollen biosynthesis.
    Ecotoxicology, 2015. 24(1): p. 163-71
    [PMID:25348600]
  3. Xiong SX, et al.
    The transcription factors MS188 and AMS form a complex to activate the expression of CYP703A2 for sporopollenin biosynthesis in Arabidopsis thaliana.
    Plant J., 2016. 88(6): p. 936-946
    [PMID:27460657]
  4. Verma N,Burma PK
    Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum.
    Plant J., 2017. 92(3): p. 481-494
    [PMID:28849604]
  5. Li DD,Xue JS,Zhu J,Yang ZN
    Gene Regulatory Network for Tapetum Development in Arabidopsis thaliana.
    Front Plant Sci, 2017. 8: p. 1559
    [PMID:28955355]