PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29563
Common NameSELMODRAFT_439283
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family Dof
Protein Properties Length: 65aa    MW: 7667.85 Da    PI: 10.2881
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29563genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.53.9e-401065257
  zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrk 57
            +++ lkcprCds+ntkfCyynnysl+qPr+fCk+C+ryWtkGGalrnvPvGgg+rk
   29563 10 SDQVLKCPRCDSMNTKFCYYNNYSLTQPRHFCKNCKRYWTKGGALRNVPVGGGCRK 65
            57899**************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-24865IPR003851Zinc finger, Dof-type
PfamPF027011.7E-341165IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.051465IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101652IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 65 aa     Download sequence    Send to blast
QQERRLKPHS DQVLKCPRCD SMNTKFCYYN NYSLTQPRHF CKNCKRYWTK GGALRNVPVG  60
GGCRK
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024526087.12e-41dof zinc finger protein 2
RefseqXP_024543829.11e-41dof zinc finger protein 1-like
RefseqXP_024543830.11e-41dof zinc finger protein 1-like
SwissprotQ8LDR02e-31DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBLD8R3A84e-40D8R3A8_SELML; Uncharacterized protein
TrEMBLD8SHZ52e-41D8SHZ5_SELML; Uncharacterized protein (Fragment)
STRINGEFJ158823e-42(Selaginella moellendorffii)
STRINGEFJ332436e-41(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.19e-34OBF binding protein 4
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xu P,Chen H,Ying L,Cai W
    AtDOF5.4/OBP4, a DOF Transcription Factor Gene that Negatively Regulates Cell Cycle Progression and Cell Expansion in Arabidopsis thaliana.
    Sci Rep, 2016. 6: p. 27705
    [PMID:27297966]
  4. Ramirez-Parra E, et al.
    The transcription factor OBP4 controls root growth and promotes callus formation.
    New Phytol., 2017. 213(4): p. 1787-1801
    [PMID:27859363]
  5. Rymen B, et al.
    ABA Suppresses Root Hair Growth via the OBP4 Transcriptional Regulator.
    Plant Physiol., 2017. 173(3): p. 1750-1762
    [PMID:28167701]