PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

29567

Common Name

SELMODRAFT_29567

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

Dof

Protein Properties

Length: 61aa MW: 7239.09 Da PI: 10.1215

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
29567	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	66.4	4.7e-21	7	61	3	57
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrk 57 ++ +cprC+s nt+f yynn qPr+ C+aC++ Wt+GG +r Gg +rk 29567 7 DNVYQCPRCQSYNTRFDYYNNEKRDQPRFACRACKKQWTQGGKIRAASSGGRKRK 61 67889******************************************99998887 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	9.0E-11	6	61	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	2.1E-27	7	61	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	19.787	10	61	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 61 aa Download sequence Send to blast
EPHELPDNVY QCPRCQSYNT RFDYYNNEKR DQPRFACRAC KKQWTQGGKI RAASSGGRKR 60 K

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024523888.1	4e-39	dof zinc finger protein DOF3.1-like
Swissprot	Q9FZA4	6e-14	DOF14_ARATH; Dof zinc finger protein DOF1.4
TrEMBL	D8QY07	4e-38	D8QY07_SELML; Uncharacterized protein (Fragment)
STRING	EFJ35120	7e-39	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP38	17	445

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G28310.2	2e-16	Dof family protein

Link Out ? help Back to Top
Phytozome	29567
Entrez Gene	9643459

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031]