![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 29613.m000372 | ||||||||
| Common Name | LOC8267077, RCOM_0504000 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 117aa MW: 13033 Da PI: 8.5683 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 129.6 | 1.4e-40 | 5 | 104 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96
+CaaCk+lrr+C++dC+++pyfp+++p++fa+vhk++Gasnv kll++lp r a++sl+yeA++r++dPvyG+vgvi+ l+qq+++++++la+
29613.m000372 5 RCAACKYLRRRCPSDCIFSPYFPSSDPQRFACVHKIYGASNVGKLLQQLPAYLRASAADSLYYEAQCRIQDPVYGCVGVISLLHQQIHNAENQLAK 100
6**********************************************************************************************9 PP
DUF260 97 lkee 100
+++e
29613.m000372 101 TRAE 104
9987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 24.453 | 4 | 105 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 2.3E-40 | 5 | 102 | IPR004883 | Lateral organ boundaries, LOB |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0016020 | Cellular Component | membrane | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 117 aa Download sequence Send to blast |
MICGRCAACK YLRRRCPSDC IFSPYFPSSD PQRFACVHKI YGASNVGKLL QQLPAYLRAS 60 AADSLYYEAQ CRIQDPVYGC VGVISLLHQQ IHNAENQLAK TRAEIAVLSS FAQDITK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 1e-38 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 1e-38 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00381 | DAP | Transfer from AT3G26620 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 29613.m000372 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002530717.1 | 4e-82 | LOB domain-containing protein 24 | ||||
| Swissprot | P59467 | 1e-52 | LBD23_ARATH; LOB domain-containing protein 23 | ||||
| Swissprot | P59468 | 1e-52 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
| TrEMBL | B9SXJ8 | 8e-81 | B9SXJ8_RICCO; LOB domain-containing protein, putative | ||||
| STRING | XP_002530717.1 | 1e-81 | (Ricinus communis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF3697 | 30 | 66 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G26660.1 | 4e-55 | LOB domain-containing protein 24 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 29613.m000372 |
| Entrez Gene | 8267077 |




