PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

29617

Common Name

CDF1B-1, SELMODRAFT_437759

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

Dof

Protein Properties

Length: 56aa MW: 6499.51 Da PI: 10.544

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
29617	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	124.2	4.1e-39	2	56	5	59
zf-Dof 5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 ++cprC s++tkfCy+nny+++qPr+fCk+C+ryWt+GG+lrnvPvG+grrk+k 29617 2 LVPCPRCSSMDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTLRNVPVGAGRRKSK 56 579**************************************************87 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	8.0E-26	1	56	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	4.2E-33	2	56	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	28.593	3	56	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	5	41	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010214	Biological Process	seed coat development
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 56 aa Download sequence Send to blast
KLVPCPRCSS MDTKFCYFNN YNVNQPRHFC KNCQRYWTAG GTLRNVPVGA GRRKSK

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269\|PubMed:19619493}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00166	DAP	Transfer from AT1G29160	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269\|PubMed:19619493}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002961848.1	3e-34	AT-rich interactive domain-containing protein 1B
Refseq	XP_002980804.1	3e-34	hormone receptor 4
Swissprot	P68350	7e-34	DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBL	M0TC18	1e-33	M0TC18_MUSAM; Uncharacterized protein
STRING	GSMUA_Achr6P32240_001	2e-34	(Musa acuminata)
STRING	EFJ17989	1e-33	(Selaginella moellendorffii)
STRING	EFJ37108	1e-33	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP38	17	445

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G29160.1	3e-36	Dof family protein

Link Out ? help Back to Top
Phytozome	29617
Entrez Gene	9629646

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Bueso E, et al. Arabidopsis COGWHEEL1 links light perception and gibberellins with seed tolerance to deterioration. Plant J., 2016. 87(6): p. 583-96 [PMID:27227784]