![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 29631.m001031 | ||||||||
| Common Name | RCOM_0528450 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 88aa MW: 10546.9 Da PI: 8.2308 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 52.9 | 8.4e-17 | 11 | 56 | 3 | 48 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
WT+eEd l++++++ G g+W+ I++ g++R++k+c++rw++yl
29631.m001031 11 LWTEEEDRTLLEYIRENGRGRWNHIPQLTGLKRCGKSCRLRWLNYL 56
5********************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 22.206 | 4 | 60 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-21 | 5 | 59 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.6E-13 | 8 | 58 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 4.9E-16 | 11 | 56 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 1.28E-22 | 11 | 83 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 5.30E-10 | 12 | 56 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.4E-8 | 60 | 83 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 7.719 | 61 | 88 | IPR017930 | Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MKGENEYKKS LWTEEEDRTL LEYIRENGRG RWNHIPQLTG LKRCGKSCRL RWLNYLNPSI 60 KRGDFSEEEE DLIIRLHNLL GNSSSTHW |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 9e-15 | 6 | 82 | 24 | 99 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 29631.m001031 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025014255.1 | 1e-53 | transcription factor WER | ||||
| Swissprot | Q9SEI0 | 2e-37 | WER_ARATH; Transcription factor WER | ||||
| TrEMBL | B9SHA9 | 5e-57 | B9SHA9_RICCO; R2r3-myb transcription factor, putative | ||||
| STRING | XP_002525378.1 | 8e-58 | (Ricinus communis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF31 | 34 | 817 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G14750.1 | 1e-39 | myb domain protein 66 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 29631.m001031 |




