PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

29656.m000479

Common Name

RCOM_0572630

Organism

Ricinus communis

Taxonomic ID

3988

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus

Family

MYB

Protein Properties

Length: 127aa MW: 14264.4 Da PI: 8.4955

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
29656.m000479	genome	JCVI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53.1	7.3e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEde+l+ +++ G g+W+t ++ g+ R++k+c++rw +yl 29656.m000479 14 KGAWTREEDERLIAYIQANGEGCWRTLPKAAGLLRCGKSCRLRWINYL 61 79****************************99**********97 PP
2	Myb_DNA-binding	25.3	3.6e-08	67	98	1	29
TSSS-HHHHHHHHHHHHHTTTT...-HHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg...tWktIar 29 rg++T eEdel+++++ +lG++ +Wk++ 29656.m000479 67 RGNFTVEEDELIIELHSLLGNNnlsHWKAVGG 98 89**************************9975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.5E-23	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	21.902	9	65	IPR017930	Myb domain
SMART	SM00717	4.4E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	2.2E-14	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.01E-22	15	88	IPR009057	Homeodomain-like
CDD	cd00167	6.28E-9	16	61	No hit	No description
PROSITE profile	PS50090	6.319	62	110	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	1.3E-10	65	97	IPR009057	Homeodomain-like
SMART	SM00717	3.7	66	118	IPR001005	SANT/Myb domain
Pfam	PF00249	1.2E-5	67	97	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 127 aa Download sequence Send to blast
MGRSPCCEKA HTNKGAWTRE EDERLIAYIQ ANGEGCWRTL PKAAGLLRCG KSCRLRWINY 60 LRPDLKRGNF TVEEDELIIE LHSLLGNNNL SHWKAVGGKL CVSTAVWDCQ TARNAVAAGA 120 TIMIYWT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	3e-16	13	87	26	99	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	29656.m000479

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015581158.1	1e-59	myb-related protein 308, partial
Swissprot	Q9SZP1	3e-56	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	B9SUH5	7e-89	B9SUH5_RICCO; R2r3-myb transcription factor, putative
STRING	XP_002529644.1	1e-89	(Ricinus communis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38620.1	5e-52	myb domain protein 4

Link Out ? help Back to Top
Phytozome	29656.m000479

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]