![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 29706.m001288 | ||||||||
| Common Name | RCOM_0652920 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 106aa MW: 12249.4 Da PI: 10.5843 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 62.9 | 6.3e-20 | 23 | 70 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd +l+++++ +G ++Wk +a++ g++R++k+c++rw++yl
29706.m001288 23 KGSWTPEEDRKLAEVIAIHGAKRWKMVAAKAGLNRCGKSCRLRWLNYL 70
799********************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 2.3E-23 | 18 | 73 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 26.757 | 18 | 74 | IPR017930 | Myb domain |
| SMART | SM00717 | 3.3E-16 | 22 | 72 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.2E-18 | 23 | 70 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 7.18E-22 | 24 | 98 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 4.74E-12 | 25 | 70 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 4.9E-7 | 74 | 97 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 106 aa Download sequence Send to blast |
MKRETKTIEP AMASLPIKQE VNKGSWTPEE DRKLAEVIAI HGAKRWKMVA AKAGLNRCGK 60 SCRLRWLNYL RPNIKRGNIS DQEEDLILRL HKLLGNRSFL MTDNFC |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 5e-17 | 23 | 97 | 7 | 80 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. | |||||
| UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Regulates the epidermal cell fate specification. Mediates the formation of columellae and accumulation of mucilages on seed coats. Controls the elongation of epidermal cells positively in roots but negatively in stems, leading to the promotion of primary roots elongation and repression of leaves and stems elongation, respectively. Ovoids ectopic root-hair formation, probably by inducing GL2 in roots. Controls trichome initiation and branching. {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15668208, ECO:0000269|PubMed:15728674}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 29706.m001288 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KM034681 | 4e-43 | KM034681.1 Jatropha curcas clone JcMYB061 MYB family protein gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002521333.2 | 2e-65 | transcription factor WER | ||||
| Swissprot | P10290 | 3e-32 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
| Swissprot | Q96276 | 2e-32 | MYB23_ARATH; Transcription factor MYB23 | ||||
| TrEMBL | B9S5R4 | 8e-73 | B9S5R4_RICCO; R2r3-myb transcription factor, putative | ||||
| STRING | XP_002521333.1 | 1e-73 | (Ricinus communis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2148 | 32 | 88 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G40330.1 | 1e-34 | myb domain protein 23 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 29706.m001288 |




