![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 29740.m000472 | ||||||||
| Common Name | RCOM_0713180 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 50aa MW: 5630.16 Da PI: 5.5997 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 33.4 | 1.3e-10 | 1 | 37 | 61 | 97 |
DUF260 61 lvyeAearardPvyGavgvilklqqqleqlkaelall 97
+vyeA+ar+r PvyG++g i++l+ q+++l+a++a+
29740.m000472 1 MVYEANARIRHPVYGSAGEIRQLKGQVKELQAQIAEE 37
69*******************************9875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03195 | 2.9E-8 | 1 | 36 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 50 aa Download sequence Send to blast |
MVYEANARIR HPVYGSAGEI RQLKGQVKEL QAQIAEEVSE NESNSNSNFH |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 29740.m000472 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025014967.1 | 4e-23 | LOB domain-containing protein 11, partial | ||||
| TrEMBL | B9SUM9 | 1e-27 | B9SUM9_RICCO; Uncharacterized protein | ||||
| STRING | XP_002529698.1 | 2e-28 | (Ricinus communis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G07900.1 | 2e-11 | LOB domain-containing protein 1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 29740.m000472 |




