![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 29805.m001471 | ||||||||
| Common Name | LOC8283808, RCOM_0819270 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 89aa MW: 9981.76 Da PI: 10.2219 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 134.1 | 3.4e-42 | 22 | 89 | 3 | 70 |
S1FA 3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
v+ ve+kG+nPGlivllv+gg++l+fl+gny+ly+yaqk+lPP+kkkPvskkk+kre+l+qGv++PGe
29805.m001471 22 VKDVETKGFNPGLIVLLVIGGIVLTFLIGNYVLYMYAQKTLPPKKKKPVSKKKMKRERLRQGVSAPGE 89
6789***************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD019013 | 4.0E-7 | 22 | 89 | No hit | No description |
| Pfam | PF04689 | 1.8E-40 | 25 | 89 | IPR006779 | DNA binding protein S1FA |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
MDDEFEFADH SPPSFQNMGN VVKDVETKGF NPGLIVLLVI GGIVLTFLIG NYVLYMYAQK 60 TLPPKKKKPV SKKKMKRERL RQGVSAPGE |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 29805.m001471 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002525167.1 | 2e-59 | DNA-binding protein S1FA | ||||
| Swissprot | Q42337 | 1e-16 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
| TrEMBL | B9SGP8 | 4e-58 | B9SGP8_RICCO; DNA-binding protein S1FA, putative | ||||
| STRING | XP_002525167.1 | 7e-59 | (Ricinus communis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF5409 | 33 | 55 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G37120.1 | 8e-08 | S1FA-like DNA-binding protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 29805.m001471 |
| Entrez Gene | 8283808 |




