![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 29838.m001690 | ||||||||
| Common Name | RCOM_0885720 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 61aa MW: 7042.28 Da PI: 10.9484 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 89.8 | 1.4e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+i+n + rqvtfskRr g++KKA+ELS+LCdae+a+++fs tgkl+ey+s
29838.m001690 9 KKIDNITARQVTFSKRRRGLFKKAYELSTLCDAEIALLVFSATGKLFEYAS 59
68***********************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.6E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 29.688 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 8.63E-28 | 2 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 6.48E-34 | 3 | 60 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.6E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.1E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.6E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.6E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0055114 | Biological Process | oxidation-reduction process | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0032440 | Molecular Function | 2-alkenal reductase [NAD(P)] activity | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 61 aa Download sequence Send to blast |
MTRQKIQIKK IDNITARQVT FSKRRRGLFK KAYELSTLCD AEIALLVFSA TGKLFEYASS 60 R |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 6e-21 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_B | 6e-21 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_C | 6e-21 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_D | 6e-21 | 1 | 60 | 1 | 60 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that mediates floral transition in response to vernalization. Promotes inflorescence fate in apical meristems. Acts in a dosage-dependent manner. Probably involved in the transduction of RLK-mediated signaling (e.g. IMK3 pathway). Together with AP1 and SVP, controls the identity of the floral meristem and regulates expression of class B, C and E genes. When associated with SOC1, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development. Confers inflorescence characteristics to floral primordia and early flowering. {ECO:0000269|PubMed:12451184, ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:12881501, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18466303, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 29838.m001690 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by vernalization in a FLC-independent manner. Repressed by the floral homeotic genes AP1, LFY and SEP3 in emerging floral meristems to establish a floral identity and prevent inflorescence fate. Up-regulated at the shoot apex by SOC1. {ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18694458}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU334633 | 1e-57 | EU334633.1 Euphorbia esula dormancy associated MADS-box protein (DAM1) gene, complete cds. | |||
| GenBank | JX966351 | 1e-57 | JX966351.1 Euphorbia esula clone BAC_DAM3 DAM3 (DAM3) gene, complete cds, alternatively spliced. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015576953.1 | 8e-36 | MADS-box protein SVP | ||||
| Refseq | XP_025013770.1 | 8e-36 | MADS-box protein SVP | ||||
| Refseq | XP_025013771.1 | 8e-36 | MADS-box protein SVP | ||||
| Swissprot | O82794 | 8e-30 | AGL24_ARATH; MADS-box protein AGL24 | ||||
| TrEMBL | B9S9I4 | 8e-36 | B9S9I4_RICCO; Mads box protein, putative | ||||
| STRING | XP_002522653.1 | 1e-36 | (Ricinus communis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF119 | 33 | 360 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G24540.1 | 3e-32 | AGAMOUS-like 24 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 29838.m001690 |




