![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 29889.m003351 | ||||||||
| Common Name | RCOM_1002180 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 83aa MW: 9347.35 Da PI: 6.5192 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 26.6 | 1.4e-08 | 34 | 63 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30
rg+WT eEd +l+++++ G g+W++ ar
29889.m003351 34 RGPWTVEEDFKLINYIATQGEGRWNSLARS 63
89*************************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50090 | 7.062 | 29 | 62 | IPR017877 | Myb-like domain |
| SuperFamily | SSF46689 | 1.05E-7 | 32 | 63 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 2.0E-9 | 32 | 64 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 1.2E-6 | 34 | 62 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 9.50E-5 | 36 | 62 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 83 aa Download sequence Send to blast |
MDVKVTHSNN QKSSSSSTTT ATQSEDEMMS ELRRGPWTVE EDFKLINYIA TQGEGRWNSL 60 ARSAAKQQLA NLSWIIYNGL SLH |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor contributing to the regulation of stamen maturation and male fertility in response to jasmonate signaling. Required for correct timing of anther dehiscence. Acts as a negative regulator of abscisic acid-induced cell death. Not involved in the regulation of BOI. Regulated by MYB21 and at a lower level by MYB24. Negatively regulated by the proteasome in an SCF(COI1) E3 ubiquitin-protein ligase complex-dependent manner. {ECO:0000269|PubMed:14555693, ECO:0000269|PubMed:19091873, ECO:0000269|PubMed:20921156, ECO:0000269|PubMed:23952703}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 29889.m003351 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated by jasmonate and pathogen infection. {ECO:0000269|PubMed:14555693, ECO:0000269|PubMed:19091873}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025013100.1 | 6e-37 | transcription factor MYB108 | ||||
| Swissprot | Q9LDE1 | 8e-16 | MY108_ARATH; Transcription factor MYB108 | ||||
| TrEMBL | B9RZW0 | 2e-54 | B9RZW0_RICCO; R2r3-myb transcription factor, putative | ||||
| STRING | XP_002519279.1 | 4e-55 | (Ricinus communis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G06490.1 | 2e-17 | myb domain protein 108 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 29889.m003351 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




