![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 29933.m001452 | ||||||||
| Common Name | RCOM_1096530 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 90aa MW: 10509.9 Da PI: 10.1837 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 53.6 | 5.2e-17 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg W++eEde+l+ +++++G +W++ ++ g+ R++k+c++rw +yl
29933.m001452 16 RGTWSPEEDEKLIAYINRYGIWNWNAMPKAAGLSRSGKSCRLRWMNYL 63
89******************99************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 18.9 | 11 | 67 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 4.2E-23 | 11 | 66 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 3.0E-13 | 15 | 65 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 3.1E-15 | 16 | 63 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 2.9E-23 | 17 | 90 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 6.26E-10 | 18 | 63 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 3.6E-10 | 67 | 90 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 8.364 | 68 | 90 | IPR017930 | Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 90 aa Download sequence Send to blast |
MTTATSESDH QTPLKRGTWS PEEDEKLIAY INRYGIWNWN AMPKAAGLSR SGKSCRLRWM 60 NYLRPNIKRG NFTKEEEETI INLHKTLGNR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 2e-16 | 14 | 90 | 5 | 80 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 29933.m001452 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002524710.2 | 7e-61 | transcription factor MYB4 | ||||
| Swissprot | Q7XBH4 | 3e-35 | MYB4_ORYSJ; Transcription factor MYB4 | ||||
| TrEMBL | B9SFE1 | 2e-60 | B9SFE1_RICCO; R2r3-myb transcription factor, putative | ||||
| STRING | XP_002524710.1 | 3e-61 | (Ricinus communis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF31 | 34 | 817 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G31180.1 | 4e-37 | myb domain protein 14 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 29933.m001452 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




