![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 30027.m000837 | ||||||||
| Common Name | RCOM_1255960 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 88aa MW: 10215.8 Da PI: 10.4372 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 61.1 | 2.4e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd++l+d+++++G g+W+ ++ g++R++k+c++rw +yl
30027.m000837 14 KGPWTAEEDQKLIDYIQKHGHGRWRILPKNAGLKRCGKSCRLRWTNYL 61
79********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 9.0E-28 | 5 | 64 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 25.967 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 6.6E-16 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 9.8E-18 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 5.13E-25 | 15 | 88 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 4.74E-12 | 16 | 61 | No hit | No description |
| PROSITE profile | PS50090 | 4.066 | 62 | 88 | IPR017877 | Myb-like domain |
| Gene3D | G3DSA:1.10.10.60 | 5.1E-8 | 65 | 88 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MGKSSCCDKN GLKKGPWTAE EDQKLIDYIQ KHGHGRWRIL PKNAGLKRCG KSCRLRWTNY 60 LRPDIKRGKF SFEEEQAIIQ MHSVLGNK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 5e-19 | 12 | 88 | 5 | 80 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. | |||||
| UniProt | Transcription factor involved in salt stress response. Confers tolerance to salt stress (PubMed:22575450). Involved in distinct cellular processes in response to osmotic stress, including control of primary metabolism and negative regulation of short-term transcriptional responses to osmotic stress (PubMed:19211694). Can activate the steps necessary for aliphatic suberin synthesis and deposition of cell wall-associated suberin-like lamellae. Involved in the production of aliphatic suberin under abiotic stress conditions (PubMed:25060192). {ECO:0000269|PubMed:19211694, ECO:0000269|PubMed:22575450, ECO:0000269|PubMed:25060192}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 30027.m000837 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. | |||||
| UniProt | INDUCTION: Induced by salt stress (PubMed:19211694, PubMed:25060192). Induced by osmotic stress (PubMed:19211694). Induced by abscisic acid (PubMed:25060192). {ECO:0000269|PubMed:19211694, ECO:0000269|PubMed:25060192}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025014328.1 | 5e-60 | LOW QUALITY PROTEIN: transcription factor MYB102-like | ||||
| Swissprot | Q9LDR8 | 4e-54 | MY102_ARATH; Transcription factor MYB102 | ||||
| Swissprot | Q9M0J5 | 1e-54 | MYB41_ARATH; Transcription factor MYB41 | ||||
| TrEMBL | A0A438FKH0 | 1e-55 | A0A438FKH0_VITVI; Transcription factor MYB102 | ||||
| TrEMBL | B9SIG0 | 3e-59 | B9SIG0_RICCO; R2r3-myb transcription factor, putative | ||||
| TrEMBL | F6H2F3 | 1e-55 | F6H2F3_VITVI; Uncharacterized protein | ||||
| STRING | VIT_19s0014g03820.t01 | 2e-56 | (Vitis vinifera) | ||||
| STRING | XP_002525779.1 | 5e-60 | (Ricinus communis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF31 | 34 | 817 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G28110.1 | 4e-57 | myb domain protein 41 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 30027.m000837 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




