![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 30073.m002276 | ||||||||
| Common Name | RCOM_1326950 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 84aa MW: 9605.82 Da PI: 5.7092 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 84.9 | 1.1e-26 | 9 | 67 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl+k y++++d+++++++sws++ nsf+v++ ef+k++LpkyFkh+nf+SFvRQLn+Y
30073.m002276 9 FLSKSYDMVDDPSTNSVVSWSSSDNSFIVWNVGEFQKELLPKYFKHNNFSSFVRQLNTY 67
9********************999**********************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 1.0E-27 | 3 | 67 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 3.0E-21 | 5 | 81 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 1.29E-23 | 7 | 67 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 3.5E-22 | 9 | 67 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 9.3E-16 | 9 | 32 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 9.3E-16 | 47 | 59 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 9.3E-16 | 60 | 72 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 84 aa Download sequence Send to blast |
MESNTVPPFL SKSYDMVDDP STNSVVSWSS SDNSFIVWNV GEFQKELLPK YFKHNNFSSF 60 VRQLNTYVGL VAWLLNFAKG YSVV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5u_B | 1e-21 | 6 | 67 | 26 | 87 | Heat shock factor protein 1 |
| 5d5v_B | 1e-21 | 6 | 67 | 26 | 87 | Heat shock factor protein 1 |
| 5d5v_D | 1e-21 | 6 | 67 | 26 | 87 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 30073.m002276 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015575202.1 | 5e-40 | heat stress transcription factor A-1b isoform X2 | ||||
| Swissprot | Q9SCW5 | 6e-30 | HFA1E_ARATH; Heat stress transcription factor A-1e | ||||
| TrEMBL | B9S233 | 1e-53 | B9S233_RICCO; Uncharacterized protein | ||||
| STRING | XP_002520052.1 | 2e-54 | (Ricinus communis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G02990.1 | 6e-24 | heat shock transcription factor A1E | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 30073.m002276 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




