![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 30074.m001414 | ||||||||
| Common Name | RCOM_1333830 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 63aa MW: 7149.34 Da PI: 8.7839 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 46.1 | 6.4e-15 | 4 | 45 | 1 | 42 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
++i n s r tf +Rr+g+lKK +EL +LC++ ++ iifs
30074.m001414 4 EFITNVSVRRMTFRQRRAGLLKKLKELATLCGIVACAIIFSA 45
6899************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.5E-11 | 1 | 55 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 13.526 | 1 | 44 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 2.62E-15 | 2 | 58 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00266 | 4.28E-18 | 4 | 56 | No hit | No description |
| Pfam | PF00319 | 7.0E-14 | 5 | 45 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 63 aa Download sequence Send to blast |
MKHEFITNVS VRRMTFRQRR AGLLKKLKEL ATLCGIVACA IIFSAYDSSP DVWPSPAEAF 60 DDF |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the development of gametophytes and seeds. {ECO:0000269|PubMed:12815071}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 30074.m001414 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by MEA, FIS2 and FIE in seeds, and by PKL after germination. {ECO:0000269|PubMed:12815071, ECO:0000269|PubMed:16359393}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006376234.1 | 6e-28 | agamous-like MADS-box protein AGL80 | ||||
| Swissprot | O80805 | 5e-15 | PHE1_ARATH; MADS-box transcription factor PHERES 1 | ||||
| TrEMBL | B9S751 | 1e-39 | B9S751_RICCO; Mads box protein, putative | ||||
| STRING | XP_002521820.1 | 2e-40 | (Ricinus communis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF14464 | 11 | 15 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G05860.2 | 3e-20 | M-type_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 30074.m001414 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




