![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 30076.m004701 | ||||||||
| Common Name | LOC8265164, RCOM_1348190 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 122aa MW: 13733.8 Da PI: 9.9918 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 56.6 | 3.5e-18 | 31 | 65 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C C+tt Tp+WR+gp g+ktLCnaCG++yrkk +
30076.m004701 31 CIDCQTTRTPCWRSGPAGPKTLCNACGIRYRKKSR 65
889*****************************976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF57716 | 2.99E-14 | 24 | 66 | No hit | No description |
| SMART | SM00401 | 2.0E-13 | 25 | 75 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 1.0E-15 | 26 | 80 | IPR013088 | Zinc finger, NHR/GATA-type |
| PROSITE profile | PS50114 | 11.82 | 29 | 61 | IPR000679 | Zinc finger, GATA-type |
| CDD | cd00202 | 3.26E-13 | 30 | 81 | No hit | No description |
| Pfam | PF00320 | 5.5E-16 | 31 | 65 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 31 | 56 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 122 aa Download sequence Send to blast |
MMIFDLNTNV QESGMDKNQN STTSSEFKKS CIDCQTTRTP CWRSGPAGPK TLCNACGIRY 60 RKKSRRILGV EKGGAEKRKG KLVKAAEVRY KDIFQEQWKR KLGEEEQAAF LLMALSYGCV 120 SA |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 30076.m004701 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002515326.1 | 4e-87 | GATA transcription factor 16 isoform X2 | ||||
| Swissprot | Q9FJ10 | 6e-28 | GAT16_ARATH; GATA transcription factor 16 | ||||
| TrEMBL | B9RNI7 | 9e-86 | B9RNI7_RICCO; GATA transcription factor, putative | ||||
| STRING | XP_002515326.1 | 1e-86 | (Ricinus communis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1569 | 32 | 98 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G49300.1 | 2e-30 | GATA transcription factor 16 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 30076.m004701 |
| Entrez Gene | 8265164 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




