PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

30147.m013751

Common Name

RCOM_1496270

Organism

Ricinus communis

Taxonomic ID

3988

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus

Family

MYB_related

Protein Properties

Length: 50aa MW: 5751.65 Da PI: 10.4882

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
30147.m013751	genome	JCVI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	34	6.9e-11	15	46	1	32
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g W++eEd++l ++v ++G g+W++++ g 30147.m013751 15 KGLWSPEEDQKLRNYVLKHGHGCWSSVPINAG 46 688************************98776 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	3.5E-13	10	50	IPR009057	Homeodomain-like
SuperFamily	SSF46689	5.31E-10	10	50	IPR009057	Homeodomain-like
PROSITE profile	PS51294	15.948	10	50	IPR017930	Myb domain
Pfam	PF00249	3.3E-9	15	46	IPR001005	SANT/Myb domain
CDD	cd00167	5.00E-6	18	41	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 50 aa Download sequence Send to blast
MGCKFSDKPK PKHRKGLWSP EEDQKLRNYV LKHGHGCWSS VPINAGIPHR

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269\|PubMed:11581165, ECO:0000269\|PubMed:19482971}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	30147.m013751

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015580996.1	7e-27	transcription factor LAF1 isoform X2
Swissprot	Q9M0K4	2e-13	LAF1_ARATH; Transcription factor LAF1
TrEMBL	B9R9C4	2e-29	B9R9C4_RICCO; R2r3-myb transcription factor, putative
STRING	XP_002510799.1	3e-30	(Ricinus communis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G48920.1	3e-17	myb domain protein 45

Link Out ? help Back to Top
Phytozome	30147.m013751

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]