![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 320424 | ||||||||
| Common Name | ARALYDRAFT_320424 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 94aa MW: 10989.9 Da PI: 9.7603 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 56.3 | 4e-18 | 10 | 53 | 2 | 45 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
rie+ r+ +skR++g++KKAeE+ LCd ev +i++s+t+k
320424 10 RIESLKERSSKYSKRKQGLFKKAEEVALLCDCEVILIVVSPTDK 53
89***************************************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 21.418 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.2E-25 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.83E-23 | 2 | 79 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00266 | 4.62E-23 | 2 | 84 | No hit | No description |
| PRINTS | PR00404 | 2.3E-14 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.1E-17 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.3E-14 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.3E-14 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 94 aa Download sequence Send to blast |
MGRKKIKLNR IESLKERSSK YSKRKQGLFK KAEEVALLCD CEVILIVVSP TDKPTLFHTR 60 SKSFNKIYDR YCMLSLQERE ERCDLSDLYI IIT* |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 320424 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020884452.1 | 8e-52 | agamous-like MADS-box protein AGL66 | ||||
| TrEMBL | D7LDF5 | 2e-60 | D7LDF5_ARALL; Uncharacterized protein | ||||
| STRING | fgenesh1_pm.C_scaffold_4000481 | 4e-61 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM7330 | 18 | 38 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G26320.1 | 1e-51 | AGAMOUS-like 33 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 320424 |
| Entrez Gene | 9315022 |




