![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 35958 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 115aa MW: 13057 Da PI: 7.4159 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 175.3 | 6.2e-55 | 13 | 105 | 2 | 94 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
reqdrflP+an+ rimkk+lPanaki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa++tlGfe+y+ pl+vyl+ yr++
35958 13 REQDRFLPVANINRIMKKALPANAKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMSTLGFEEYIRPLRVYLQGYRNVS 105
89****************************************************************************************985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.9E-51 | 7 | 104 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 4.81E-38 | 15 | 103 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.5E-28 | 18 | 82 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.3E-19 | 46 | 64 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 49 | 65 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.3E-19 | 65 | 83 | No hit | No description |
| PRINTS | PR00615 | 1.3E-19 | 84 | 102 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 115 aa Download sequence Send to blast |
MPTAHEADAS VAREQDRFLP VANINRIMKK ALPANAKIAK DAKETVQECV SEFISFITSE 60 ASDKCQREKR KTINGDDLLW AMSTLGFEEY IRPLRVYLQG YRNVSSIFFH ELVF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 2e-45 | 13 | 102 | 3 | 92 | NF-YB |
| 4awl_B | 2e-45 | 13 | 102 | 4 | 93 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 2e-45 | 13 | 102 | 4 | 93 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CP000582 | 1e-95 | CP000582.1 Ostreococcus lucimarinus CCE9901 chromosome 2, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_001416214.1 | 2e-81 | predicted protein | ||||
| Swissprot | O23310 | 8e-58 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
| Swissprot | P25209 | 1e-57 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
| TrEMBL | A4RSN4 | 4e-80 | A4RSN4_OSTLU; Uncharacterized protein | ||||
| STRING | ABO94507 | 7e-81 | (Ostreococcus 'lucimarinus') | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Chlorophytae | OGCP2023 | 16 | 16 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 3e-60 | nuclear factor Y, subunit B3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 35958 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




