![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 38104 | ||||||||
| Common Name | HAP3A1, SELMODRAFT_450072, SmHAP3A-1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 115aa MW: 12824.5 Da PI: 7.259 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 185.2 | 5.1e-58 | 12 | 107 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
reqdrflPianvsrimk+ lP+nakiskdaketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGfedyvepl+vyl+kyre egek
38104 12 REQDRFLPIANVSRIMKRGLPGNAKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMSTLGFEDYVEPLRVYLHKYREQEGEK 107
89*******************************************************************************************997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 4.1E-53 | 10 | 108 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.17E-40 | 14 | 107 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 5.2E-28 | 17 | 81 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.4E-21 | 45 | 63 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 48 | 64 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.4E-21 | 64 | 82 | No hit | No description |
| PRINTS | PR00615 | 1.4E-21 | 83 | 101 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 115 aa Download sequence Send to blast |
GGGGNLSSLS PREQDRFLPI ANVSRIMKRG LPGNAKISKD AKETVQECVS EFISFVTGEA 60 SDKCQREKRK TINGDDLLWA MSTLGFEDYV EPLRVYLHKY REQEGEKAML AKAGE |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 6e-51 | 7 | 102 | 2 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU019899 | 0.0 | Selaginella moellendorffii CCAAT-box binding factor HAP3-like protein (HAP3A2) mRNA, partial cds | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002967268.1 | 6e-81 | nuclear transcription factor Y subunit B-8 | ||||
| Swissprot | Q75IZ7 | 1e-64 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | D8QMV1 | 1e-79 | D8QMV1_SELML; CCAAT-box binding factor HAP3-like protein | ||||
| TrEMBL | D8R7C9 | 1e-79 | D8R7C9_SELML; CCAAT-box binding factor HAP3-like protein | ||||
| STRING | EFJ31867 | 2e-80 | (Selaginella moellendorffii) | ||||
| STRING | EFJ37991 | 3e-80 | (Selaginella moellendorffii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP168 | 17 | 170 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 3e-66 | nuclear factor Y, subunit B3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 38104 |
| Entrez Gene | 9641987 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




