PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

38995

Common Name

SELMODRAFT_38995

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

ZF-HD

Protein Properties

Length: 64aa MW: 7008.89 Da PI: 5.9588

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
38995	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	105.5	3.3e-33	2	58	2	59
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 ++v+Y+eClkNhAas+Ggh++DGCgEfmp geegt++alkCaAC+CHRnFH+reve 38995 2 KTVHYRECLKNHAASIGGHSLDGCGEFMPC-GEEGTMEALKCAACDCHRNFHKREVEG 58 689************************9.999*******************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	6.0E-22	3	61	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	2.2E-30	4	56	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	2.3E-30	5	56	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	27.313	6	55	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 64 aa Download sequence Send to blast
SKTVHYRECL KNHAASIGGH SLDGCGEFMP CGEEGTMEAL KCAACDCHRN FHKREVEGEP 60 LVCD

Functional Description ? help Back to Top
Source	Description
UniProt	Putative transcription factor. Binds DNA at 5'-ATTA-3' consensus promoter regions. Regulates floral architecture and leaf development. Regulators in the abscisic acid (ABA) signal pathway that confers sensitivity to ABA in an ARF2-dependent manner. {ECO:0000269\|PubMed:16428600, ECO:0000269\|PubMed:21059647, ECO:0000269\|PubMed:21779177}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by abscisic acid (ABA) and ARF2. {ECO:0000269\|PubMed:21779177}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024541927.1	2e-40	zinc-finger homeodomain protein 1-like
Swissprot	Q9FRL5	4e-27	ZHD5_ARATH; Zinc-finger homeodomain protein 5
TrEMBL	D8SD40	2e-39	D8SD40_SELML; Uncharacterized protein (Fragment)
STRING	EFJ17963	3e-40	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP91	16	237

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G75240.1	2e-29	homeobox protein 33

Link Out ? help Back to Top
Phytozome	38995
Entrez Gene	9647209

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031]