PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

39427

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

bZIP

Protein Properties

Length: 85aa MW: 10273 Da PI: 11.5244

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
39427	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	51.6	2.1e-16	4	46	5	47
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 +r+rr++kNRe+A rsR+RK+a++ eLe +v +L++eN++L+k 39427 4 RRQRRMIKNRESAARSRARKQAYTVELEAEVTQLKEENMKLRK 46 69***************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50217	10.932	2	46	IPR004827	Basic-leucine zipper domain
SMART	SM00338	7.8E-11	2	64	IPR004827	Basic-leucine zipper domain
CDD	cd14707	2.74E-18	4	49	No hit	No description
Pfam	PF00170	4.1E-14	4	46	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	5.38E-12	4	46	No hit	No description
Gene3D	G3DSA:1.20.5.170	2.6E-16	4	47	No hit	No description
PROSITE pattern	PS00036	0	7	22	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 85 aa Download sequence Send to blast
IVERRQRRMI KNRESAARSR ARKQAYTVEL EAEVTQLKEE NMKLRKMQVR NEFFLRDFSQ 60 QALEVITPMT QHLPKMLKRT LTGPW

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that mediates abscisic acid (ABA) signaling. Binds specifically to the ABA-responsive element (ABRE) of the EMP1 and RAB16A gene promoters. {ECO:0000269\|PubMed:10611387}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (ABA). {ECO:0000269\|PubMed:10611387}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024537960.1	4e-42	bZIP transcription factor 46 isoform X1
Swissprot	Q6ZDF3	2e-24	TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBL	D8R121	2e-40	D8R121_SELML; Uncharacterized protein ABI5C-1
TrEMBL	D8S186	3e-40	D8S186_SELML; Uncharacterized protein ABI5C-2
STRING	EFJ21671	6e-41	(Selaginella moellendorffii)
STRING	EFJ33828	4e-41	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP10063	7	11

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G45249.1	6e-23	abscisic acid responsive elements-binding factor 2

Link Out ? help Back to Top
Phytozome	39427

Publications ? help Back to Top
Kagaya Y,Hobo T,Murata M,Ban A,Hattori T Abscisic acid-induced transcription is mediated by phosphorylation of an abscisic acid response element binding factor, TRAB1. Plant Cell, 2002. 14(12): p. 3177-89 [PMID:12468735] Kobayashi Y, et al. Abscisic acid-activated SNRK2 protein kinases function in the gene-regulation pathway of ABA signal transduction by phosphorylating ABA response element-binding factors. Plant J., 2005. 44(6): p. 939-49 [PMID:16359387] Kobayashi F,Maeta E,Terashima A,Takumi S Positive role of a wheat HvABI5 ortholog in abiotic stress response of seedlings. Physiol Plant, 2008. 134(1): p. 74-86 [PMID:18433415]