PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

39516

Common Name

MYB4B-1, MYB4B-2, SELMODRAFT_39507, SELMODRAFT_39516

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

MYB_related

Protein Properties

Length: 87aa MW: 9962.54 Da PI: 9.5152

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
39516	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54	3.9e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd+ll + + ++G g+W+t ++ g++R++k+c++rw +yl 39516 14 RGPWTREEDLLLTQHISLHGEGSWRTLPKAAGLRRCGKSCRLRWINYL 61 89********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	4.5E-24	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	22.858	9	65	IPR017930	Myb domain
SMART	SM00717	1.3E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	4.1E-15	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	2.12E-22	15	87	IPR009057	Homeodomain-like
CDD	cd00167	1.65E-9	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.7E-8	65	87	IPR009057	Homeodomain-like
PROSITE profile	PS51294	8.772	66	87	IPR017930	Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 87 aa Download sequence Send to blast
MGRAPCCEKV GLNRGPWTRE EDLLLTQHIS LHGEGSWRTL PKAAGLRRCG KSCRLRWINY 60 LRPDLKRGNI SEEEDQLIIK LHSLLGN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	2e-16	12	87	25	99	MYB TRANSFORMING PROTEIN
Search in ModeBase

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18541146, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002961794.2	4e-56	transcription factor MYB86 isoform X2
Swissprot	Q9S9K9	2e-44	MYB3_ARATH; Transcription factor MYB3
TrEMBL	D8QT48	3e-56	D8QT48_SELML; Uncharacterized protein MYB4B-1 (Fragment)
STRING	EFJ33705	4e-57	(Selaginella moellendorffii)
STRING	EFJ37054	4e-57	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22640.1	1e-46	myb domain protein 3

Link Out ? help Back to Top
Phytozome	39516
Entrez Gene	9629124 \| 9658845

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275]