PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

39810

Common Name

SELMODRAFT_39807, SELMODRAFT_39810

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

MYB_related

Protein Properties

Length: 55aa MW: 6284.29 Da PI: 10.9248

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
39810	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	50	6.9e-16	18	55	1	40
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40 r+++T+eEd +v+a++ +G++ W++Iar+++ gRt++ + 39810 18 RKPFTEEEDRAIVKAHAIHGNK-WASIARMLP-GRTDNAI 55 789*****************.*****.**975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	5.7E-9	1	25	IPR009057	Homeodomain-like
SuperFamily	SSF46689	2.14E-18	2	55	IPR009057	Homeodomain-like
PROSITE profile	PS51294	22.044	13	55	IPR017930	Myb domain
SMART	SM00717	1.5E-5	17	55	IPR001005	SANT/Myb domain
Pfam	PF00249	1.1E-13	18	55	IPR001005	SANT/Myb domain
CDD	cd00167	2.79E-10	20	55	No hit	No description
Gene3D	G3DSA:1.10.10.60	3.8E-16	26	55	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 55 aa Download sequence Send to blast
GKSCRLRWCN QLNPVVKRKP FTEEEDRAIV KAHAIHGNKW ASIARMLPGR TDNAI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	7e-21	1	55	42	96	B-MYB
Search in ModeBase

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Slightly induced by salicylic acid. {ECO:0000269\|PubMed:16463103}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002972038.2	7e-33	transcription factor MYB1
Refseq	XP_002972584.2	6e-33	transcription factor MYB1
Swissprot	Q42575	1e-24	MYB1_ARATH; Transcription factor MYB1
TrEMBL	D8RLN8	2e-33	D8RLN8_SELML; Uncharacterized protein (Fragment)
STRING	EFJ26670	4e-34	(Selaginella moellendorffii)
STRING	EFJ26955	4e-34	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G55730.1	3e-28	myb domain protein 109

Link Out ? help Back to Top
Phytozome	39810
Entrez Gene	9640681 \| 9651558

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Wang T, et al. Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1027-41 [PMID:26243618] Nguyen HT, et al. A Transcription Factor γMYB1 Binds to the P1BS cis-Element and Activates PLA2-γ Expression with its Co-Activator γMYB2. Plant Cell Physiol., 2016. 57(4): p. 784-97 [PMID:26872838] Sanz-Fernández M, et al. Screening Arabidopsis mutants in genes useful for phytoremediation. J. Hazard. Mater., 2017. 335: p. 143-151 [PMID:28441590] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]