PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information? help Back to Top

TF ID

40769

Organism

Taxonomic ID

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus

Family

Protein Properties

Length: 102aa MW: 12091.1 Da PI: 10.6478

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
40769	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	48.1	2.7e-15	3	48	2	48
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 + WT Ed+ l++++ ++G ++W+ Ia+ m +R +kqc++r++++l 40769 3 QQWTVREDKELLQLIDKYGAKRWSYIASLMR-HRRGKQCRDRYLNHL 48 78***************************.***********97 PP
2	Myb_DNA-binding	45.1	2.3e-14	55	96	2	45
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 g W++eE+++lv+++k lG++ W++ a+ + gR ++ +k++w+ 40769 55 GEWSKEEELILVEGHKVLGTK-WAALAKLLT-GRPENAIKNHWH 96 89*****************.****9.*********8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00717	4.6E-12	1	50	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	20.944	1	52	IPR017930	Myb domain
SuperFamily	SSF46689	8.03E-28	3	95	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.7E-23	4	55	IPR009057	Homeodomain-like
CDD	cd00167	3.07E-11	5	48	No hit	No description
Pfam	PF13921	1.8E-17	5	62	No hit	No description
SMART	SM00717	2.7E-11	53	101	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	16.037	53	102	IPR017930	Myb domain
CDD	cd00167	1.42E-7	56	99	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.3E-18	56	101	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 102 aa Download sequence Send to blast
MTQQWTVRED KELLQLIDKY GAKRWSYIAS LMRHRRGKQC RDRYLNHLRP GIKTGEWSKE 60 EELILVEGHK VLGTKWAALA KLLTGRPENA IKNHWHATLR CK

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules (PubMed:16214903, PubMed:17693534, PubMed:18410484, PubMed:17937500). Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte (PubMed:16214903). Involved in pollen tube guidance to the micropyle (PubMed:16214903, PubMed:17937500, PubMed:23093426). {ECO:0000269\|PubMed:16214903, ECO:0000269\|PubMed:17693534, ECO:0000269\|PubMed:17937500, ECO:0000269\|PubMed:18410484, ECO:0000269\|PubMed:23093426}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CP000595	1e-171	CP000595.1 Ostreococcus lucimarinus CCE9901 chromosome 15, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_001421720.1	4e-70	predicted protein, partial
Swissprot	Q9S7L2	3e-35	MYB98_ARATH; Transcription factor MYB98
TrEMBL	A4S888	8e-69	A4S888_OSTLU; Uncharacterized protein (Fragment)
STRING	ABP00014	1e-69	(Ostreococcus 'lucimarinus')

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Chlorophytae	OGCP15	16	114

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18770.1	1e-37	myb domain protein 98

Link Out ? help Back to Top
Phytozome	40769

Publications ? help Back to Top
Mendes MA, et al. Live and let die: a REM complex promotes fertilization through synergid cell death in Arabidopsis. Development, 2016. 143(15): p. 2780-90 [PMID:27338615]