PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

462847593

Organism

Eragrostis tef

Taxonomic ID

110835

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis

Family

GRAS

Protein Properties

Length: 61aa MW: 6935.93 Da PI: 9.9563

Description

GRAS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
462847593	genome	Tef	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	GRAS	57.2	3.6e-18	1	56	319	374
GRAS 319 leeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374 +e aGF+ vpls++a qa++ + + dg++v ee+gs++l+W+dr+++svSaWr 462847593 1 MEGAGFGRVPLSYYALLQARRAAQGLGCDGFKVREEKGSFFLCWQDRAIFSVSAWR 56 788****************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03514	1.2E-15	1	56	IPR005202	Transcription factor GRAS

Sequence ? help Back to Top
Protein Sequence Length: 61 aa Download sequence Send to blast
MEGAGFGRVP LSYYALLQAR RAAQGLGCDG FKVREEKGSF FLCWQDRAIF SVSAWRGRRF 60 D

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in plant development. {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	462847593

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK364826	1e-63	AK364826.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2028K08.
GenBank	AK365688	1e-63	AK365688.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2036F09.
GenBank	AK372202	1e-63	AK372202.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2148A03.
GenBank	AK373958	1e-63	AK373958.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3049D13.
GenBank	BT070027	1e-63	BT070027.1 Zea mays full-length cDNA clone ZM_BFb0369H02 mRNA, complete cds.
GenBank	EU950610	1e-63	EU950610.1 Zea mays clone 502636 mRNA sequence.
GenBank	EU956570	1e-63	EU956570.1 Zea mays clone 1566913 GRAS family transcription factor containing protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004971220.1	1e-35	scarecrow-like protein 3
Refseq	XP_022682001.1	1e-35	scarecrow-like protein 3
Swissprot	Q9LPR8	7e-22	SCL3_ARATH; Scarecrow-like protein 3
TrEMBL	A0A287MKE6	3e-35	A0A287MKE6_HORVV; Uncharacterized protein
TrEMBL	A0A368RFP6	2e-34	A0A368RFP6_SETIT; Uncharacterized protein
TrEMBL	A0A453GM99	4e-35	A0A453GM99_AEGTS; Uncharacterized protein
TrEMBL	K3XHR4	1e-34	K3XHR4_SETIT; Uncharacterized protein
STRING	Si001436m	2e-35	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP604	38	176

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G50420.1	1e-13	scarecrow-like 3

Publications ? help Back to Top
Gong X, et al. SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root. Plant Physiol., 2016. 170(3): p. 1675-83 [PMID:26818732] Lee SA, et al. Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue. Mol Plant, 2016. 9(6): p. 870-84 [PMID:26970019] Choi JW,Lim J Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation. Mol. Cells, 2016. 39(7): p. 524-9 [PMID:27306644]