![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462848327 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 102aa MW: 10879.3 Da PI: 4.7782 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 100.3 | 1.5e-31 | 1 | 64 | 38 | 101 |
NF-YC 38 misaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101
m aeaPv++++ace+filelt r w haeenkrrtl+ksdiaaa++rt++fdflvdivprd+
462848327 1 MTPAEAPVVFARACEMFILELTHRGWAHAEENKRRTLQKSDIAAAIARTEVFDFLVDIVPRDDA 64
5679*********************************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 7.54E-19 | 3 | 61 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 3.2E-24 | 3 | 61 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 6.8E-10 | 5 | 46 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 102 aa Download sequence Send to blast |
MTPAEAPVVF ARACEMFILE LTHRGWAHAE ENKRRTLQKS DIAAAIARTE VFDFLVDIVP 60 RDDAKDADAA AAAAAAAAAG IPRPAAGVPA TDPLAYYYVP QQ |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_B | 3e-32 | 1 | 61 | 35 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 33 | 39 | RRTLQKS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462848327 |
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FP100449 | 1e-110 | FP100449.1 Phyllostachys edulis cDNA clone: bphyst023f20, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004957138.1 | 1e-55 | nuclear transcription factor Y subunit C-6 | ||||
| Swissprot | Q9XE33 | 8e-47 | NFYC6_ORYSJ; Nuclear transcription factor Y subunit C-6 | ||||
| TrEMBL | A0A368Q2Y8 | 3e-54 | A0A368Q2Y8_SETIT; Uncharacterized protein | ||||
| STRING | GRMZM2G078691_P01 | 8e-53 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP3856 | 36 | 76 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G54830.3 | 4e-32 | nuclear factor Y, subunit C3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




