![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462848999 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | B3 | ||||||||
| Protein Properties | Length: 137aa MW: 15052.5 Da PI: 10.8537 | ||||||||
| Description | B3 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | B3 | 62 | 9.8e-20 | 6 | 70 | 33 | 99 |
-SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
B3 33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
++t+ +d +g++W++++iyr++++r++lt+GW+ Fv++++L +gD++vF +++ +el+v+++r+
462848999 6 TTTVLAKDVHGEVWKFRHIYRGTPRRHLLTTGWSTFVNQKKLVAGDSIVFL--RTELGELCVGIRRA 70
568999*********************************************..559999******97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| CDD | cd10017 | 6.48E-15 | 1 | 69 | No hit | No description |
| PROSITE profile | PS50863 | 12.689 | 1 | 71 | IPR003340 | B3 DNA binding domain |
| SuperFamily | SSF101936 | 1.57E-18 | 5 | 72 | IPR015300 | DNA-binding pseudobarrel domain |
| SMART | SM01019 | 0.0021 | 6 | 71 | IPR003340 | B3 DNA binding domain |
| Pfam | PF02362 | 1.5E-17 | 6 | 70 | IPR003340 | B3 DNA binding domain |
| Gene3D | G3DSA:2.40.330.10 | 2.5E-22 | 6 | 73 | IPR015300 | DNA-binding pseudobarrel domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 137 aa Download sequence Send to blast |
MGGGGTTTVL AKDVHGEVWK FRHIYRGTPR RHLLTTGWST FVNQKKLVAG DSIVFLRTEL 60 GELCVGIRRA KRVSCGGMEC MSGWNAPGYG GFSPFLKEEE SKLMKGPGGY MRGRGKVKIA 120 DVVDAASLAA RRAYRMR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4ldu_A | 7e-22 | 6 | 72 | 195 | 261 | Auxin response factor 5 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462848999 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT060467 | 1e-110 | BT060467.1 Zea mays full-length cDNA clone ZM_BFb0003E21 mRNA, complete cds. | |||
| GenBank | EU967025 | 1e-110 | EU967025.1 Zea mays clone 298928 mRNA sequence. | |||
| GenBank | HM004517 | 1e-110 | HM004517.1 Zea mays auxin response factor 2 (ARF2) gene, complete cds. | |||
| GenBank | JX428504 | 1e-110 | JX428504.1 Zea mays subsp. mays clone pUT3102 ARF2 ARF type transcription factor mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004982839.1 | 7e-76 | auxin response factor 22 | ||||
| Swissprot | Q9AV47 | 2e-61 | ARFV_ORYSJ; Auxin response factor 22 | ||||
| TrEMBL | A0A1E5UWA3 | 2e-75 | A0A1E5UWA3_9POAL; Auxin response factor | ||||
| STRING | Si034525m | 3e-75 | (Setaria italica) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G30080.1 | 8e-47 | auxin response factor 16 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




